SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g16410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g16410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g16410

Feature Type:gene_model
Chromosome:Gm06
Start:12877056
stop:12878556
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30330AT Annotation by Michelle Graham. TAIR10: Small nuclear ribonucleoprotein family protein | chr4:14836773-14837919 REVERSE LENGTH=88 SoyBaseE_val: 3.00E-54ISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005732GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1774 KOG Small nuclear ribonucleoprotein E JGI ISS
PTHR11193Panther SNRNP SM FAMILY MEMBER JGI ISS
PF01423PFAM LSM domain JGI ISS
UniRef100_G7IMA2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Small nuclear ribonucleoprotein E n=1 Tax=Medicago truncatula RepID=G7IMA2_MEDTR SoyBaseE_val: 1.00E-55ISS
UniRef100_I1KBP3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Papilionoideae RepID=I1KBP3_SOYBN SoyBaseE_val: 4.00E-56ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g16410 not represented in the dataset

Glyma06g16410 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g38600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g157100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g16410.1   sequence type=CDS   gene model=Glyma06g16410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAGTACCAAAGTTCAGAGGGTTATGACCCAACCTATTAACTTGATTTTCAGGTTTCTTCAGAGCAAAGCGCGCATTCAGATTTGGCTTTTTGAGCAGAAGGATTTGAGGATTGAAGGCCGAATCATCGGTTTTGATGAATACATGAATTTGGTTCTTGATGATGCTGAAGAAGTGAACGTCAAGAAGAAAAGCAGAAAGACATTAGGGAGGATCCTTCTTAAAGGAGACAACATAACCTTGATGATGAACACGGGGAAATGA

>Glyma06g16410.1   sequence type=predicted peptide   gene model=Glyma06g16410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo