SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g16340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g16340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g16340

Feature Type:gene_model
Chromosome:Gm06
Start:12825313
stop:12832063
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09220AT Annotation by Michelle Graham. TAIR10: amino acid permease 2 | chr5:2866867-2868863 FORWARD LENGTH=493 SoyBaseE_val: 0ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015800GO-bp Annotation by Michelle Graham. GO Biological Process: acidic amino acid transport SoyBaseN/AISS
GO:0015804GO-bp Annotation by Michelle Graham. GO Biological Process: neutral amino acid transport SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005887GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015171GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity SoyBaseN/AISS
KOG1303 KOG Amino acid transporters JGI ISS
PTHR22950Panther AMINO ACID TRANSPORTER JGI ISS
PF01490PFAM Transmembrane amino acid transporter protein JGI ISS
UniRef100_A7XVK0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Amino acid transporter n=1 Tax=Phaseolus vulgaris RepID=A7XVK0_PHAVU SoyBaseE_val: 0ISS
UniRef100_I1KBN2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KBN2_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g16340 not represented in the dataset

Glyma06g16340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g38650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g156600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g16340.1   sequence type=CDS   gene model=Glyma06g16340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCCTTACTCCATTGATGGTGTTTCTTCACAAACTAACTCCAAATTCTACGATGATGATGGCCATGTTAAACGAACAGGGACCGTTTGGACAACAAGCTCGCACATAATAACAGCAGTGGTGGGTTCTGGGGTGCTGTCTTTGGCATGGGCCATGGCTCAAATGGGTTGGGTTGCTGGGCCTGCAGTTATGATCTTCTTCAGTGTTGTTACGTTGTATACGACGTCGCTTCTGGCTGATTGTTATCGCTGTGGTGACCCTGTTACCGGGAAGAGAAACTATACTTTCATGGATGCAGTTCAATCCATTCTCGGTGGGTATTATGATGCATTTTGTGGGGTAGTTCAGTACTCAAATCTTTACGGAACCGCCGTAGGATACACAATTGCAGCTTCTATTAGCATGATGGCAATAAAAAGGTCCAACTGTTTCCATTCTTCAGGCGGAAAAAGTCCATGTCAGGTTTCAAGCAACCCATACATGATCGGTTTTGGCATAATCCAAATTTTATTTTCTCAAATTCCAGATTTTCATGAAACATGGTGGCTCTCCATAGTTGCAGCAATCATGTCTTTTGTCTATTCCACAATTGGGCTCGCTCTTGGCATTGCCAAAGTTGCAGAAATGGGTACTTTCAAGGGTAGTCTCACAGGAGTAAGGATTGGAACTGTGACCGAGGCCACAAAAGTATGGGGGGTTTTCCAAGGTCTTGGTGACATAGCCTTCGCCTATTCATATTCTCAAATTCTCATTGAAATTCAGGACACCATAAAATCTCCACCATCGGAAGCAAAGACAATGAAGAAGTCTGCTAAGATAAGTATTGGAGTAACCACAACATTTTATATGCTTTGTGGTTTCATGGGCTATGCTGCTTTTGGAGATTCAGCACCTGGGAACCTGCTCACAGGATTTGGTTTTTTTAACCCATATTGGCTCATAGATATTGCTAATGCTGCTATCGTAATTCACCTTGTGGGAGCATACCAAGTTTATGCCCAGCCCCTCTTTGCCTTTGTCGAGAAATGGGCTTCAAAAAGATGGCCTGAAGTTGAGACGGAATATAAAATTCCAATTCCTGGTTTTTCACCCTACAATCTAAGCCCATTTAGATTAGTTTGGAGAACAGTGTTTGTTATCATAACCACTTTTGTAGCAATGTTGATTCCATTCTTCAATGACGTTTTGGGACTTCTTGGAGCACTGGGGTTTTGGCCTTTAAGTGTTTTTCTCCCAGTGCAGATGAGTATCAAACAAAAGAGGACCCCAAGGTGGAGTGGTAGATGGATTGGTATGCAAATCTTAAGTGTTGTTTGTTTCATAGTATCAGTTGCGGCTGCTGTTGGCTCAGTTGCCAGTATCGTGCTTGACCTACAGAAATACAAACCGTTTCATGTAGACTATTAA

>Glyma06g16340.1   sequence type=predicted peptide   gene model=Glyma06g16340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEPYSIDGVSSQTNSKFYDDDGHVKRTGTVWTTSSHIITAVVGSGVLSLAWAMAQMGWVAGPAVMIFFSVVTLYTTSLLADCYRCGDPVTGKRNYTFMDAVQSILGGYYDAFCGVVQYSNLYGTAVGYTIAASISMMAIKRSNCFHSSGGKSPCQVSSNPYMIGFGIIQILFSQIPDFHETWWLSIVAAIMSFVYSTIGLALGIAKVAEMGTFKGSLTGVRIGTVTEATKVWGVFQGLGDIAFAYSYSQILIEIQDTIKSPPSEAKTMKKSAKISIGVTTTFYMLCGFMGYAAFGDSAPGNLLTGFGFFNPYWLIDIANAAIVIHLVGAYQVYAQPLFAFVEKWASKRWPEVETEYKIPIPGFSPYNLSPFRLVWRTVFVIITTFVAMLIPFFNDVLGLLGALGFWPLSVFLPVQMSIKQKRTPRWSGRWIGMQILSVVCFIVSVAAAVGSVASIVLDLQKYKPFHVDY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo