SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g15920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g15920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g15920

Feature Type:gene_model
Chromosome:Gm06
Start:12512717
stop:12514799
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09310AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Gamma-secretase aspartyl protease complex, presenilin enhancer-2 subunit (InterPro:IPR019379); Has 168 Blast hits to 168 proteins in 71 species: Archae - 0; Bacteria - 0; Metazoa - 126; Fungi - 0; Plants - 36; Viruses - 0; Other Eukaryotes - 6 (source: NCBI BLink). | chr5:2887403-2888501 REVERSE LENGTH=146 SoyBaseE_val: 6.00E-61ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3402 KOG Predicted membrane protein JGI ISS
PTHR16318Panther GAMMA-SECRETASE SUBUNIT PEN-2 JGI ISS
PF10251PFAM Presenilin enhancer-2 subunit of gamma secretase JGI ISS
UniRef100_B9SA23UniRef Annotation by Michelle Graham. Most informative UniRef hit: GDP-mannose transporter, putative n=1 Tax=Ricinus communis RepID=B9SA23_RICCO SoyBaseE_val: 2.00E-61ISS
UniRef100_I1KBJ6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KBJ6_SOYBN SoyBaseE_val: 2.00E-93ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g15920 not represented in the dataset

Glyma06g15920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g39050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g153700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g15920.1   sequence type=CDS   gene model=Glyma06g15920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCATCACAGGGCAACCATCCAAACCCTAACCCTAACCCTAACCGGAATAATTCCGTTGCGTCGTCGGTGCCGGTGTGGCCAACCATCGACGGCCCATTGGGCCTGTCGGAGGAAGAATCAGTGGGCTACGCTCGCAGGTTCTACAAGTTCGGCTTCGCCCTTCTCCCTCTCCTATGGGCCGTCAATTGCTTCTACTTCTGGCCCGCCCTTCGCCACTCTCACTCCTTCCCCCGCATTCGCCCCTATGTTGTTGGATCTGCAATTGGGTTTGCAGTATTTGCGACACTTCTCAGTTCTTGGGCTCTAACATTTGCCATTGGAGGGGAACGTCTCTTCGGCCCTGTTTGGGATCAATTGGTTATGTACAATCTTGCTGATAGGTTAGGCTTAACAGGCTGGAGCTAG

>Glyma06g15920.1   sequence type=predicted peptide   gene model=Glyma06g15920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEASQGNHPNPNPNPNRNNSVASSVPVWPTIDGPLGLSEEESVGYARRFYKFGFALLPLLWAVNCFYFWPALRHSHSFPRIRPYVVGSAIGFAVFATLLSSWALTFAIGGERLFGPVWDQLVMYNLADRLGLTGWS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo