Glyma06g15890 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g15890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g15890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g15890

Feature Type:	gene_model
Chromosome:	Gm06
Start:	12500229
stop:	12501933
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g15890

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G74880	AT	Annotation by Michelle Graham. TAIR10: NAD(P)H:plastoquinone dehydrogenase complex subunit O \| chr1:28130112-28131020 REVERSE LENGTH=158	SoyBase	E_val: 1.00E-60	ISS
GO:0010155	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of proton transport	SoyBase	N/A	ISS
GO:0010258	GO-bp	Annotation by Michelle Graham. GO Biological Process: NADH dehydrogenase complex (plastoquinone) assembly	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0046777	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0010598	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: NAD(P)H dehydrogenase complex (plastoquinone)	SoyBase	N/A	ISS
GO:0016655	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	SoyBase	N/A	ISS
PF11910	PFAM	Cyanobacterial and plant NDH-1 subunit O	JGI		ISS
UniRef100_C6T2F5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2F5_SOYBN	SoyBase	E_val: 3.00E-109	ISS
UniRef100_G7JBK8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit n=1 Tax=Medicago truncatula RepID=G7JBK8_MEDTR	SoyBase	E_val: 5.00E-68	ISS

Expression Patterns of Glyma06g15890

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g15890 not represented in the dataset	Glyma06g15890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g15890 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g153400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g15890

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g15890

Limit To All Plant Sequences

>Glyma06g15890.1   sequence type=CDS   gene model=Glyma06g15890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTTCTCTGCTACTCTATCCTACACCTCCTTCCCTTGCCTTCCTCGTTTCCCGCAAACTTTGAGAACAAAAAGTGTTCATTTCCCTCTGATTCGTGCAGTGCAAGGTGGTCAAGCAGAGACACCCGAGAGCAAGAAGAGTGAAGGGTCATCTAATGCTCAGTCTTCAAGTGCTGCTGCTCCTAAACCCAAGAAACCCGTCTATTCCTTGAAGAAAGGTCAGATTGTGAGGGTGGACAAGGAGAAATATCTCAATAGCGTCAATTATCTTTCTGTTGGGCACCCACCTTATTACAAAGGATTAGATTACATTTATGAGGACCGTGGTGAGGTCCTGGATATGCGTATATTTGAAACGGGAGAATATGCACTTATTGCGTGGGTAGGGGTCCCCACTGCTCCAGCATGGCTTCCTACGGACATGCTTATCAAGTCAGAGAAACTCAATTATGAGAGGTTATGA

Predicted protein sequences of Glyma06g15890

Limit To All Plant Sequences

>Glyma06g15890.1   sequence type=predicted peptide   gene model=Glyma06g15890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFSATLSYTSFPCLPRFPQTLRTKSVHFPLIRAVQGGQAETPESKKSEGSSNAQSSSAAAPKPKKPVYSLKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDMRIFETGEYALIAWVGVPTAPAWLPTDMLIKSEKLNYERL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain