SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g15650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g15650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g15650

Feature Type:gene_model
Chromosome:Gm06
Start:12323616
stop:12324690
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g15650
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18690AT Annotation by Michelle Graham. TAIR10: MAP kinase substrate 1 | chr3:6429755-6430423 REVERSE LENGTH=222 SoyBaseE_val: 3.00E-27ISS
GO:0009870GO-bp Annotation by Michelle Graham. GO Biological Process: defense response signaling pathway, resistance gene-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF05678PFAM VQ motif JGI ISS
UniRef100_G7LD80UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein MKS1 n=1 Tax=Medicago truncatula RepID=G7LD80_MEDTR SoyBaseE_val: 8.00E-75ISS
UniRef100_I1KBH6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KBH6_SOYBN SoyBaseE_val: 8.00E-157ISS

Proteins Associated with Glyma06g15650
LocusGene SymbolProtein Name
VQ25 VQ motif containing protein gene 25

Expression Patterns of Glyma06g15650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g15650 not represented in the dataset
Glyma06g15650 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g15650
ParalogEvidenceComments
Glyma04g39270 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g15650 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g151400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g15650
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g15650
>Glyma06g15650.2   sequence type=CDS   gene model=Glyma06g15650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCCGCCGGAGATTCCCTTCGGCGGAGCCCCGCTGCCGAAGAAAGAGCTTCAACTCCAGGGTCCGCGGCCGCCGCCTCTCAAAGTCAGCAAAGAATCTCACAAGATCAAGAAGCCGCCGCCGCACCCGGCGCACCACCACCACAACTACCCCCACGCGCCGCCGGACCAGAACCTACAACAACAGCGGGAACCAGTGATAATCTACTCCGTCTCCCCGAAAGTCATCCACGTCACCCCCGGCGACTTCATGGACGTGGTCCAGCGCCTCACCGGAGCTTCCATCGGCGAAGAACCGCCGTCGGGACGCGGCGACGTGTCTCCGGCGGCGAGGCTGGCCTCGATTGAGAAGACGAGTCCTTCGGAGAGAGAAAGAGAAAGGGTTTTGCACAACATAGACGACAACATCGCGTGGATGTTGGGGGAGGGAGTGGAAGTAGGTCAATTTCCGGGGATACTGACGCCGGAGCCGGGAACCTTGCCGCCGATTCCGGCGGAGGTATTTTCGCCGGTGAGAGAGGCGCAAACGGCGGCGTCGTATTGGAACGACTTTTCACCGTCGTATTGGTCGGCGAGCAGCTTCTTGGCGAGTCCGTCGGGGTTTCTTTCCGTCACCGTGGCGTCCCCGCAGCCGTCGCCGAACCTGTTCAGCCTCTTCGACTTGTAA
Predicted protein sequences of Glyma06g15650
>Glyma06g15650.2   sequence type=predicted peptide   gene model=Glyma06g15650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPPEIPFGGAPLPKKELQLQGPRPPPLKVSKESHKIKKPPPHPAHHHHNYPHAPPDQNLQQQREPVIIYSVSPKVIHVTPGDFMDVVQRLTGASIGEEPPSGRGDVSPAARLASIEKTSPSERERERVLHNIDDNIAWMLGEGVEVGQFPGILTPEPGTLPPIPAEVFSPVREAQTAASYWNDFSPSYWSASSFLASPSGFLSVTVASPQPSPNLFSLFDL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo