Glyma06g15620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g15620

Feature Type:	gene_model
Chromosome:	Gm06
Start:	12281600
stop:	12281833
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g15620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G18715	AT	Annotation by Michelle Graham. TAIR10: inflorescence deficient in abscission (IDA)-like 4 \| chr3:6441067-6441348 FORWARD LENGTH=93	SoyBase	E_val: 2.00E-10	ISS
UniRef100_G7JAZ0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein IDA-like protein n=1 Tax=Medicago truncatula RepID=G7JAZ0_MEDTR	SoyBase	E_val: 3.00E-26	ISS
UniRef100_I1KBH3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KBH3_SOYBN	SoyBase	E_val: 7.00E-46	ISS

Expression Patterns of Glyma06g15620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g15620

Paralog	Evidence	Comments
Glyma04g39310	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g15620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g151100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g15620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g15620

Limit To All Plant Sequences

>Glyma06g15620.1   sequence type=CDS   gene model=Glyma06g15620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAGCTCTACGTAGTAGGAGACATAAAACTCTATTGCTCTTGCTGATCTTGTTTCTATGCATATTGGGGCACGGCCATGGATCAAGAACCACCAACGTCTTCAAGTTGAAACCCAAATCTCAGCACACTGGTCACTTTTTTGGGTTCTTGCCAAAGAGGATACACATACCGTTCTCCTCTCCTTCAAAGAAACACAATGACATTGGCCTACAAAGTTTGAGATCACCCTAA

Predicted protein sequences of Glyma06g15620

Limit To All Plant Sequences

>Glyma06g15620.1   sequence type=predicted peptide   gene model=Glyma06g15620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLALRSRRHKTLLLLLILFLCILGHGHGSRTTNVFKLKPKSQHTGHFFGFLPKRIHIPFSSPSKKHNDIGLQSLRSP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain