Report for Sequence Feature Glyma06g15560
Feature Type: gene_model
Chromosome: Gm06
Start: 12262534
stop: 12263373
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Expression Patterns of Glyma06g15560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma06g15560 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g150600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g15560
Coding sequences of Glyma06g15560
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g15560.1 sequence type=CDS gene model=Glyma06g15560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCGAGCATGACTTGCTGTGGGGTTTTCTATCGACGCGACGAAGGTGGTGGTTTTCTACGGGAACAAGCGGTGGCTGTCCGATCTCGGTGCCTTTTTGTCGTCATCGGCGAGGGTAAAATGTACGTGGCGGCAAAAATGAGTGCGAAAGAGAAGAGACAGAGAGAGACTCCGAGGGTGGTAGCGGAGCAGGGGTAG
Predicted protein sequences of Glyma06g15560
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g15560.1 sequence type=predicted peptide gene model=Glyma06g15560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSSMTCCGVFYRRDEGGGFLREQAVAVRSRCLFVVIGEGKMYVAAKMSAKEKRQRETPRVVAEQG*