SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g15310

Feature Type:gene_model
Chromosome:Gm06
Start:12072345
stop:12073738
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g15310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G64770AT Annotation by Michelle Graham. TAIR10: Encodes a root meristem growth factor (RGF). Belongs to a family of functionally redundant homologous peptides that are secreted, tyrosine-sulfated, and expressed mainly in the stem cell area and the innermost layer of central columella cells. RGFs are required for maintenance of the root stem cell niche and transit amplifying cell proliferation. Members of this family include: At5g60810 (RGF1), At1g13620 (RGF2), At2g04025 (RGF3), At3g30350 (RGF4), At5g51451 (RGF5), At4g16515 (RGF6), At3g02240 ( SoyBaseE_val: 4.00E-12ISS
GO:0008284GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation SoyBaseN/AISS
GO:0009958GO-bp Annotation by Michelle Graham. GO Biological Process: positive gravitropism SoyBaseN/AISS
GO:0022622GO-bp Annotation by Michelle Graham. GO Biological Process: root system development SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0032880GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein localization SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:2000012GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of auxin polar transport SoyBaseN/AISS
GO:0005615GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular space SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
GO:0008083GO-mf Annotation by Michelle Graham. GO Molecular Function: growth factor activity SoyBaseN/AISS
UniRef100_I1KBD6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KBD6_SOYBN SoyBaseE_val: 5.00E-53ISS
UniRef100_Q9FGF6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Root meristem growth factor 9 n=1 Tax=Arabidopsis thaliana RepID=RGF9_ARATH SoyBaseE_val: 2.00E-09ISS

Expression Patterns of Glyma06g15310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g15310
ParalogEvidenceComments
Glyma04g39556 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g15310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g148100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g15310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g15310
>Glyma06g15310.1   sequence type=CDS   gene model=Glyma06g15310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTATGTCACCAAGCAAACGTTGCCTTCTTGTTGCTTTTCTCTTGCTTTGCTTCCTTTCTATTAATGCTACAGCCAGAAAATTAAGAGAGACTAAGGATGAATTAGCTCCAGTTTTGACGACTGAGAAGAGCCATGAAAATCAATTTAAGCCAAACCAAGGAGGGGGAGGGGAACAAGATCTTGGTGACTTGGCTACAATGGACTACACTCCTGCAAAAAAGAATCCTCCAATTCACAATTAA
Predicted protein sequences of Glyma06g15310
>Glyma06g15310.1   sequence type=predicted peptide   gene model=Glyma06g15310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMSPSKRCLLVAFLLLCFLSINATARKLRETKDELAPVLTTEKSHENQFKPNQGGGGEQDLGDLATMDYTPAKKNPPIHN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo