SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g15300

Feature Type:gene_model
Chromosome:Gm06
Start:12062482
stop:12063181
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g15300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G09890AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3511) | chr4:6218501-6218764 FORWARD LENGTH=87 SoyBaseE_val: 6.00E-17ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF12023PFAM Domain of unknown function (DUF3511) JGI ISS
UniRef100_I1KBD5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KBD5_SOYBN SoyBaseE_val: 1.00E-61ISS

Expression Patterns of Glyma06g15300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g15300 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g148000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g15300
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g15300
>Glyma06g15300.1   sequence type=CDS   gene model=Glyma06g15300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACATGGAGAAAGGCAAACCCTTCTCTGCCTATCATCATTCCAGTTCCTATCACGACTTCAGGGCTGGGTTGGAGGATCGAACCACATCTTACAGCTTCAACGGTCCAAGAAGCAGCAAAAGAGATGTTCTGGCCACTAATGGTAACCCAGAGCTCAAAAGAAGAAAAAGGGTAGCATCCTACAACATGTACACCATTGAAGCTAAGCTCAAATCCTCTTTTCGCAGCAGTTTCAAATGGATCAAAAACAAGCTTTGTAGACCACTATTATCACTATGA
Predicted protein sequences of Glyma06g15300
>Glyma06g15300.1   sequence type=predicted peptide   gene model=Glyma06g15300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNMEKGKPFSAYHHSSSYHDFRAGLEDRTTSYSFNGPRSSKRDVLATNGNPELKRRKRVASYNMYTIEAKLKSSFRSSFKWIKNKLCRPLLSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo