Report for Sequence Feature Glyma06g14960
Feature Type: gene_model
Chromosome: Gm06
Start: 11733595
stop: 11737770
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g14960
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G10920 AT
Annotation by Michelle Graham. TAIR10: manganese superoxide dismutase 1 | chr3:3418015-3419581 FORWARD LENGTH=231
SoyBase E_val: 1.00E-129 ISS
GO:0006094 GO-bp
Annotation by Michelle Graham. GO Biological Process: gluconeogenesis
SoyBase N/A ISS
GO:0006096 GO-bp
Annotation by Michelle Graham. GO Biological Process: glycolysis
SoyBase N/A ISS
GO:0006511 GO-bp
Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process
SoyBase N/A ISS
GO:0006801 GO-bp
Annotation by Michelle Graham. GO Biological Process: superoxide metabolic process
SoyBase N/A ISS
GO:0006833 GO-bp
Annotation by Michelle Graham. GO Biological Process: water transport
SoyBase N/A ISS
GO:0006972 GO-bp
Annotation by Michelle Graham. GO Biological Process: hyperosmotic response
SoyBase N/A ISS
GO:0007030 GO-bp
Annotation by Michelle Graham. GO Biological Process: Golgi organization
SoyBase N/A ISS
GO:0009060 GO-bp
Annotation by Michelle Graham. GO Biological Process: aerobic respiration
SoyBase N/A ISS
GO:0009266 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus
SoyBase N/A ISS
GO:0009651 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salt stress
SoyBase N/A ISS
GO:0009793 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy
SoyBase N/A ISS
GO:0009853 GO-bp
Annotation by Michelle Graham. GO Biological Process: photorespiration
SoyBase N/A ISS
GO:0010043 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to zinc ion
SoyBase N/A ISS
GO:0019430 GO-bp
Annotation by Michelle Graham. GO Biological Process: removal of superoxide radicals
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0046686 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cadmium ion
SoyBase N/A ISS
GO:0051788 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to misfolded protein
SoyBase N/A ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:0080129 GO-bp
Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0004784 GO-mf
Annotation by Michelle Graham. GO Molecular Function: superoxide dismutase activity
SoyBase N/A ISS
GO:0005507 GO-mf
Annotation by Michelle Graham. GO Molecular Function: copper ion binding
SoyBase N/A ISS
GO:0046872 GO-mf
Annotation by Michelle Graham. GO Molecular Function: metal ion binding
SoyBase N/A ISS
KOG0876
KOG
Manganese superoxide dismutase
JGI ISS
PTHR11404 Panther
SUPEROXIDE DISMUTASE 2
JGI ISS
PTHR11404:SF5 Panther
SUPEROXIDE DISMUTASE
JGI ISS
PF00081 PFAM
Iron/manganese superoxide dismutases, alpha-hairpin domain
JGI ISS
PF02777 PFAM
Iron/manganese superoxide dismutases, C-terminal domain
JGI ISS
UniRef100_A5JVZ7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Superoxide dismutase n=1 Tax=Glycine max RepID=A5JVZ7_SOYBN
SoyBase E_val: 1.00E-175 ISS
UniRef100_A5JVZ7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Superoxide dismutase n=1 Tax=Glycine max RepID=A5JVZ7_SOYBN
SoyBase E_val: 1.00E-175 ISS
Expression Patterns of Glyma06g14960
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g14960
Paralog Evidence Comments
Glyma04g39930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g14960 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g144500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g14960
Coding sequences of Glyma06g14960
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g14960.1 sequence type=CDS gene model=Glyma06g14960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCGCGCGAGCTCTGTTGACCAGAAAAACCCTAGCCACCGTGCTCCGCAACGACGCGAAGCCCATAATCGGAGTTGGCATAACAGCAGCGGCTACTCATTCACGCGGGTTGCACGTGTACACGCTACCCGATCTGGATTACGACTATGGCGCACTGGAGCCAGCCATCAGCGGCGACATCATGCAGCTGCACCACCAGAAGCACCACCAGACTTACATCACCAACTACAACAAGGCCCTCGAGCAGCTCCAAGACGCCATCGCCAAGAAAGATTCCTCCGCCGTCGTTAAGCTCCAGGGCGCCATCAAGTTCAACGGCGGAGGTCATGTCAACCATTCTATTTTCTGGAAAAATCTAGCTCCTGTTCGTGAAGGAGGTGGTGAACCACCCAAGGGTTCACTGGGATGGGCTATTGACACACATTTTGGTTCTTTTGAAGCATTAATACAAAAAGTTAACGCAGAAGGTGCTGCACTACAGGGGTCTGGATGGGTGTGGCTTGGTCTGGACAAAGAGTTGAAGAGGCTTGTAGTTGAAACCACTGCCAACCAGGACCCACTGGTTACTAAGGGACCAAATTTGGTTCCATTGATTGGTATTGATGTTTGGGAGCATGCGTACTACTTACAGTACAAGAATGTTAGACCAGACTATCTTAAGAACATTTGGAAAGTTATTAATTGGAAATATGCCAGTGAAGTGTATGAGAAAGAGAGCTCTTAG
Predicted protein sequences of Glyma06g14960
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g14960.1 sequence type=predicted peptide gene model=Glyma06g14960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAARALLTRKTLATVLRNDAKPIIGVGITAAATHSRGLHVYTLPDLDYDYGALEPAISGDIMQLHHQKHHQTYITNYNKALEQLQDAIAKKDSSAVVKLQGAIKFNGGGHVNHSIFWKNLAPVREGGGEPPKGSLGWAIDTHFGSFEALIQKVNAEGAALQGSGWVWLGLDKELKRLVVETTANQDPLVTKGPNLVPLIGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESS*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
