SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g14960

Feature Type:gene_model
Chromosome:Gm06
Start:11733595
stop:11737770
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G10920AT Annotation by Michelle Graham. TAIR10: manganese superoxide dismutase 1 | chr3:3418015-3419581 FORWARD LENGTH=231 SoyBaseE_val: 1.00E-129ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006801GO-bp Annotation by Michelle Graham. GO Biological Process: superoxide metabolic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0019430GO-bp Annotation by Michelle Graham. GO Biological Process: removal of superoxide radicals SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004784GO-mf Annotation by Michelle Graham. GO Molecular Function: superoxide dismutase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
KOG0876 KOG Manganese superoxide dismutase JGI ISS
PTHR11404Panther SUPEROXIDE DISMUTASE 2 JGI ISS
PTHR11404:SF5Panther SUPEROXIDE DISMUTASE JGI ISS
PF00081PFAM Iron/manganese superoxide dismutases, alpha-hairpin domain JGI ISS
PF02777PFAM Iron/manganese superoxide dismutases, C-terminal domain JGI ISS
UniRef100_A5JVZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Superoxide dismutase n=1 Tax=Glycine max RepID=A5JVZ7_SOYBN SoyBaseE_val: 1.00E-175ISS
UniRef100_A5JVZ7UniRef Annotation by Michelle Graham. Best UniRef hit: Superoxide dismutase n=1 Tax=Glycine max RepID=A5JVZ7_SOYBN SoyBaseE_val: 1.00E-175ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g39930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g144500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g14960.1   sequence type=CDS   gene model=Glyma06g14960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGCGCGAGCTCTGTTGACCAGAAAAACCCTAGCCACCGTGCTCCGCAACGACGCGAAGCCCATAATCGGAGTTGGCATAACAGCAGCGGCTACTCATTCACGCGGGTTGCACGTGTACACGCTACCCGATCTGGATTACGACTATGGCGCACTGGAGCCAGCCATCAGCGGCGACATCATGCAGCTGCACCACCAGAAGCACCACCAGACTTACATCACCAACTACAACAAGGCCCTCGAGCAGCTCCAAGACGCCATCGCCAAGAAAGATTCCTCCGCCGTCGTTAAGCTCCAGGGCGCCATCAAGTTCAACGGCGGAGGTCATGTCAACCATTCTATTTTCTGGAAAAATCTAGCTCCTGTTCGTGAAGGAGGTGGTGAACCACCCAAGGGTTCACTGGGATGGGCTATTGACACACATTTTGGTTCTTTTGAAGCATTAATACAAAAAGTTAACGCAGAAGGTGCTGCACTACAGGGGTCTGGATGGGTGTGGCTTGGTCTGGACAAAGAGTTGAAGAGGCTTGTAGTTGAAACCACTGCCAACCAGGACCCACTGGTTACTAAGGGACCAAATTTGGTTCCATTGATTGGTATTGATGTTTGGGAGCATGCGTACTACTTACAGTACAAGAATGTTAGACCAGACTATCTTAAGAACATTTGGAAAGTTATTAATTGGAAATATGCCAGTGAAGTGTATGAGAAAGAGAGCTCTTAG

>Glyma06g14960.1   sequence type=predicted peptide   gene model=Glyma06g14960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAARALLTRKTLATVLRNDAKPIIGVGITAAATHSRGLHVYTLPDLDYDYGALEPAISGDIMQLHHQKHHQTYITNYNKALEQLQDAIAKKDSSAVVKLQGAIKFNGGGHVNHSIFWKNLAPVREGGGEPPKGSLGWAIDTHFGSFEALIQKVNAEGAALQGSGWVWLGLDKELKRLVVETTANQDPLVTKGPNLVPLIGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo