Glyma06g14875 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g14875

Feature Type:	gene_model
Chromosome:	Gm06
Start:	11674213
stop:	11675954
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g14875

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G11280	AT	Annotation by Michelle Graham. TAIR10: Duplicated homeodomain-like superfamily protein \| chr3:3533477-3534393 REVERSE LENGTH=263	SoyBase	E_val: 6.00E-13	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR25040	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR25040:SF29	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_G7L8M9	UniRef	Annotation by Michelle Graham. Best UniRef hit: DIV1B protein n=1 Tax=Medicago truncatula RepID=G7L8M9_MEDTR	SoyBase	E_val: 3.00E-35	ISS
UniRef100_G7L8M9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DIV1B protein n=1 Tax=Medicago truncatula RepID=G7L8M9_MEDTR	SoyBase	E_val: 3.00E-35	ISS

Expression Patterns of Glyma06g14875

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g14875 not represented in the dataset	Glyma06g14875 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g14875

Paralog	Evidence	Comments
Glyma04g39975	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g14875 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g143600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g14875

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g14875

Limit To All Plant Sequences

>Glyma06g14875.1   sequence type=CDS   gene model=Glyma06g14875   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATATGTCTTCCACCGCTATCTAGTTGCTCTCTCTCTCTCTCTCTCTCTCTCTCAACAATGGTGGCTGAAATCATTGATCTTTCAGACTCCCCTCCATCATCACCCTGGTCATCTCATAATGATGCAGCAAGAATTCTCAATTTTGATTCTGTTTCTAATGAAAAAAATCAATTTGAGAAAGTTATTCCTATATCCTTAATGGCTTGCACAAATCCCAACCAGCCACAAACTAGTCTATGGCGAGCTGCTTCAAGACATACCAATGAGCACTCTCAGATTGCTACTACATTCCAACCCAGCATGCAATTACAAAGGGTTGCTACAGTACTTGAACCAGTACCTGAATCAATCACATGCATGTTTCCTCATGGAGCTAGACTCAAGGAGCCCTGGACTCACAGAGAACATGAGCTATTTTTGATGGGGCTAATAAAGTATGGAAAAGGTCACTGGAGCAAAATTGCTAGACACTTTTTGTTGAATAAGACACCACAACAAGTTCAGAGCTATGGTGCAAGCTTCTTCAGGAATCTACCATCTACACACCTACATGGTTTTAGGAGAAGGAAGCCAAGCTACTCGACATCTAGCCTCATGTCCAAAAACAACAACCTTATGGCTGCATCTGCATCTACCACCTCATACTTCATGCCTATGATTGTTAATGAGCCACAACAAACTCACATGTTTTTCCCAGAGAATGCTCCTTTAAATTTTCTTCTGGCCCCATCACATGGAGAAGCAAGTAGCAGCAACAACAACACCACCATGTATGGGTTCCAGATGCAGACAAGTGGTGCAAGAACTTCCATGAATGCTAGTGCTAATGGAGAAGTTGATTTGGAACTGCGTTTGGGTTGA

Predicted protein sequences of Glyma06g14875

Limit To All Plant Sequences

>Glyma06g14875.1   sequence type=predicted peptide   gene model=Glyma06g14875   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MICLPPLSSCSLSLSLSLSTMVAEIIDLSDSPPSSPWSSHNDAARILNFDSVSNEKNQFEKVIPISLMACTNPNQPQTSLWRAASRHTNEHSQIATTFQPSMQLQRVATVLEPVPESITCMFPHGARLKEPWTHREHELFLMGLIKYGKGHWSKIARHFLLNKTPQQVQSYGASFFRNLPSTHLHGFRRRKPSYSTSSLMSKNNNLMAASASTTSYFMPMIVNEPQQTHMFFPENAPLNFLLAPSHGEASSSNNNTTMYGFQMQTSGARTSMNASANGEVDLELRLG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain