SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g14841

Feature Type:gene_model
Chromosome:Gm06
Start:11625761
stop:11628873
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40620AT Annotation by Michelle Graham. TAIR10: Basic-leucine zipper (bZIP) transcription factor family protein | chr2:16954804-16956872 REVERSE LENGTH=367 SoyBaseE_val: 3.00E-22ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
UniRef100_I1JYB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JYB6_SOYBN SoyBaseE_val: 1.00E-78ISS
UniRef100_Q0GPI5UniRef Annotation by Michelle Graham. Most informative UniRef hit: BZIP transcription factor bZIP85 (Fragment) n=1 Tax=Glycine max RepID=Q0GPI5_SOYBN SoyBaseE_val: 3.00E-31ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g14841 not represented in the dataset

Glyma06g14841 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g40010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g143200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g14841.1   sequence type=CDS   gene model=Glyma06g14841   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTTCTCTCACCACCGTCGATCTCAATCCGAGATGCATTTCCGCATCCCCAACGACTTCGACCTCGAGGTGGATCTCTCTCCGCCGCATCATTTCCAAGATCCGGTCCCAAGCAACTCCCCCGACGCCTCTTCCTCCTCGTTGGTCGACGCCATTGATGCCGAGAAGGCCTTGTCCCCCTATAAGCTCGCTCAATTGTGGACCGTTGATCCCAAACGAGCCAAGAGGTACAGAGATACAACTGGTCTGACTACTGAAAATACGGAGTTGAAGCTTAGGTTACAAGGCATGGAACAACAAGCTAACTTATGTGATGCACTGAAGAACGAAGTTGATAGGCTCAAGATTGCAACTGGAGAGATAGTAATGCATACCGATGCCTATGACATTCCCTATGATTTGTCAGAAATGTTGTCAAGTGAATCCATCGGCCAATTTCAGGGACTGGACATAGGCAACGGGGTTTCTCATAATCTGATGCCAGATTGTCCATCCATTTGTGTTAATAATATCAACAATGCCTTTTGA

>Glyma06g14841.1   sequence type=predicted peptide   gene model=Glyma06g14841   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFSHHRRSQSEMHFRIPNDFDLEVDLSPPHHFQDPVPSNSPDASSSSLVDAIDAEKALSPYKLAQLWTVDPKRAKRYRDTTGLTTENTELKLRLQGMEQQANLCDALKNEVDRLKIATGEIVMHTDAYDIPYDLSEMLSSESIGQFQGLDIGNGVSHNLMPDCPSICVNNINNAF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo