SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g14750

Feature Type:gene_model
Chromosome:Gm06
Start:11557509
stop:11560012
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g14750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G56380AT Annotation by Michelle Graham. TAIR10: response regulator 17 | chr3:20905480-20906368 FORWARD LENGTH=153 SoyBaseE_val: 2.00E-62ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000156GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity SoyBaseN/AISS
PTHR26402Panther RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM JGI ISS
PTHR26402:SF51Panther JGI ISS
PF00072PFAM Response regulator receiver domain JGI ISS
UniRef100_B9S4F7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Two-component system sensor histidine kinase/response regulator, putative n=1 Tax=Ricinus communis RepID=B9S4F7_RICCO SoyBaseE_val: 5.00E-70ISS
UniRef100_C6TAY9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TAY9_SOYBN SoyBaseE_val: 9.00E-102ISS

Proteins Associated with Glyma06g14750
LocusGene SymbolProtein Name
RR16 Ubiquitous, Response Regulator Type-A
RR16 Ubiquitous, Response Regulator Type-A

Expression Patterns of Glyma06g14750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g14750
ParalogEvidenceComments
Glyma04g40100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g14750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g142300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g14750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g14750
>Glyma06g14750.1   sequence type=CDS   gene model=Glyma06g14750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCAGGTTCTTCTTCAAATTGGGTCATGGAAAGTGGTGATGTTCCTCATGTTTTGGCCGTTGATGACAACCTTATTGATCGCAAACTCGTTGAGAAACTCCTCAGGAATTCTTCTTGCAAAGTTACAACTGCAGAAAATGGGCCAAGGGCATTGGAATTATTGGGCTTAACAAGTGGTGGACAGAACACCATGAACGGTAGATCCAAAGTAAATATGGTTATCACAGACTATTGCATGCCAGGGATGACAGGCTACGAGCTACTTAAGAAAATCAAGGAATCGTCGGTAACGAAGGAGGTTCCAGTAGTGATCATGTCATCTGAGAACATACCAACACGAATTAACAAGTGTCTGGAAGAAGGAGCTCAGATGTTCATTCTAAAGCCCCTCAAACAATCTGATGTAAAAAAACTGACATGTCAGTTAATGAATTGA
Predicted protein sequences of Glyma06g14750
>Glyma06g14750.1   sequence type=predicted peptide   gene model=Glyma06g14750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAGSSSNWVMESGDVPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPRALELLGLTSGGQNTMNGRSKVNMVITDYCMPGMTGYELLKKIKESSVTKEVPVVIMSSENIPTRINKCLEEGAQMFILKPLKQSDVKKLTCQLMN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo