SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g14610

Feature Type:gene_model
Chromosome:Gm06
Start:11457111
stop:11459837
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g14610
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26910AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L16p/L10e family protein | chr1:9321709-9322813 FORWARD LENGTH=221 SoyBaseE_val: 2.00E-147ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0032502GO-bp Annotation by Michelle Graham. GO Biological Process: developmental process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0857 KOG 60s ribosomal protein L10 JGI ISS
PTHR11726Panther 60S RIBOSOMAL PROTEIN L10 JGI ISS
PF00252PFAM Ribosomal protein L16p/L10e JGI ISS
UniRef100_B3TLM0UniRef Annotation by Michelle Graham. Most informative UniRef hit: QM-like protein n=1 Tax=Elaeis guineensis RepID=B3TLM0_ELAGV SoyBaseE_val: 1.00E-154ISS
UniRef100_UPI00018C6BA0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C6BA0 related cluster n=1 Tax=unknown RepID=UPI00018C6BA0 SoyBaseE_val: 7.00E-164ISS

Expression Patterns of Glyma06g14610
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g14610
ParalogEvidenceComments
Glyma04g40200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g14610 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g140900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g14610
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g14610
>Glyma06g14610.1   sequence type=CDS   gene model=Glyma06g14610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAGGAGGCCTGCAAGGTGTTACCGGCAGATAAAAAACAAGCCATACCCCAAATCACGTTTCTGCCGTGGTGTTCCTGATCCTAAGATCAGAATTTATGATGTTGGTATGAAGAAGAAAGGTGTTGATGAGTTTCCCTTCTGCGTTCATCTGGTTAGCTGGGAAAAAGAAAATGTTTCAAGTGAAGCATTGGAAGCTGCTAGAATTGCATGCAACAAATATATGGCGAAATTTGCTGGAAAGGATGCTTTCCACTTGAGAGTCAGAGTACATCCATTCCATGTTCTTAGGATCAACAAAATGCTTTCATGTGCTGGAGCTGATAGGCTTCAGACTGGAATGAGAGGTGCATTTGGAAAGCCACAGGGAACATGTGCTAGAGTCGCCATTGGTCAGGTTCTTCTTTCTGTCCGCTGTAAGGACAGCAACAGTCATCATGCACAGGAGGCTCTTCGTCGTGCTAAGTTTAAGTTCCCTGGTCGTCAAAAGATCATAGTTAGCAGGAAATGGGGTTTCACCAAGTTCAGCCGTGCTGATTATCTCAAGTACAAGTCAGAGAGCAGGATTGTGCCTGATGGTGTGAATGCTAAGCTTCTTGGGTGCCATGGACCACTGGCAAACCGTCAACCTGGACAAGCTTTTTTATCTAGTGCTACTGCTACTGCTTAG
Predicted protein sequences of Glyma06g14610
>Glyma06g14610.1   sequence type=predicted peptide   gene model=Glyma06g14610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLKYKSESRIVPDGVNAKLLGCHGPLANRQPGQAFLSSATATA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo