SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g14601

Feature Type:gene_model
Chromosome:Gm06
Start:11451599
stop:11456244
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g14601
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G10850AT Annotation by Michelle Graham. TAIR10: Metallo-hydrolase/oxidoreductase superfamily protein | chr3:3397756-3399522 REVERSE LENGTH=258 SoyBaseE_val: 6.00E-118ISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0019243GO-bp Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004416GO-mf Annotation by Michelle Graham. GO Molecular Function: hydroxyacylglutathione hydrolase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
KOG0813 KOG Glyoxylase JGI ISS
PTHR11935Panther BETA LACTAMASE DOMAIN JGI ISS
PTHR11935:SF7Panther GLYOXYLASE-RELATED JGI ISS
PF00753PFAM Metallo-beta-lactamase superfamily JGI ISS
UniRef100_G7KDB9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hydroxyacylglutathione hydrolase n=1 Tax=Medicago truncatula RepID=G7KDB9_MEDTR SoyBaseE_val: 2.00E-126ISS
UniRef100_UPI000233978CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233978C related cluster n=1 Tax=unknown RepID=UPI000233978C SoyBaseE_val: 3.00E-162ISS

Expression Patterns of Glyma06g14601
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g14601 not represented in the dataset
Glyma06g14601 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g14601
ParalogEvidenceComments
Glyma04g40210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g14601 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g140800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g14601
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g14601
>Glyma06g14601.1   sequence type=CDS   gene model=Glyma06g14601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATCGTTGACGAGAGCACCAAAGAAGGTGCGGTGGTGGACCCTGTAGAGCCTCAGAAAGTTCTAGAAGCTGCCAATTCTCATGGGGTCAATAATCTCAAGCTTGTCCTCACCACACATCATCACGGGGATCATGCTGGTGGAAATGAAAAGATAAAGCAATTGGTGCTTGGAATGAAGGTCTATGGTGGTTCAATGGATAACATCAAGGGTTGCACTGATAAGGTTGAAAATGGGGATAAGATGTCACTTGGGGCTGATATTAATATATTGTGTCTTCACACACCTTGCCACACCAAAGGTCACATAAGCTATTGTGTTACTGGCAAAGAGGAGGAAGTTCTTAGGAAAGAATACAATAAATTGATTCTAAAAGCTATGCCAAAGTTTATTGCTGGTTGTGGGAAATTTTTTGAAGGAACTGCAGAACAGATATATCAGTCACTCTGTGTGACATTAGGTTCATTACCAAAGCCAACCAGAGTTTACTGTGGCCATGAGTATGCAGTGAGGAACTTGCTATTTGCTCTGACAATTGAGCCAGATAATTTGAGGATACAACAAAAATTAACATGGGCTAAGAATCAGCAGCAAGCTGGCCAATCTACAATTCCCTCCACCATTGAGGAAGAAATGGAAACCAACCCATTTATGAGGGTCAACCTACCTGAGATTCAGGGTGCAAGTCTCCCCGTTGAAGCTTTAAGAGAGTTACGGAAGCTGAAAGACAAGTGGAAGGGGGTAATGGAATTAACTAATTACTGCATACTCCATGTGTAG
Predicted protein sequences of Glyma06g14601
>Glyma06g14601.1   sequence type=predicted peptide   gene model=Glyma06g14601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IVDESTKEGAVVDPVEPQKVLEAANSHGVNNLKLVLTTHHHGDHAGGNEKIKQLVLGMKVYGGSMDNIKGCTDKVENGDKMSLGADINILCLHTPCHTKGHISYCVTGKEEEVLRKEYNKLILKAMPKFIAGCGKFFEGTAEQIYQSLCVTLGSLPKPTRVYCGHEYAVRNLLFALTIEPDNLRIQQKLTWAKNQQQAGQSTIPSTIEEEMETNPFMRVNLPEIQGASLPVEALRELRKLKDKWKGVMELTNYCILHV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo