Glyma06g14360 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g14360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g14360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g14360

Feature Type:	gene_model
Chromosome:	Gm06
Start:	11298930
stop:	11300077
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g14360

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G33140	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L6 family \| chr1:12023360-12024502 FORWARD LENGTH=194	SoyBase	E_val: 2.00E-119	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009955	GO-bp	Annotation by Michelle Graham. GO Biological Process: adaxial/abaxial pattern specification	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0015934	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
GO:0019843	GO-mf	Annotation by Michelle Graham. GO Molecular Function: rRNA binding	SoyBase	N/A	ISS
KOG3255	KOG	60S ribosomal protein L9	JGI		ISS
PTHR11655	Panther	60S RIBOSOMAL PROTEIN L9 FAMILY MEMBER	JGI		ISS
PTHR11655:SF2	Panther	50S RIBOSOMAL PROTEIN L6	JGI		ISS
PF00347	PFAM	Ribosomal protein L6	JGI		ISS
UniRef100_C6TJH2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJH2_SOYBN	SoyBase	E_val: 3.00E-136	ISS
UniRef100_G7J9M6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L9 n=1 Tax=Medicago truncatula RepID=G7J9M6_MEDTR	SoyBase	E_val: 6.00E-123	ISS

Expression Patterns of Glyma06g14360

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g14360 not represented in the dataset	Glyma06g14360 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g14360 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g138700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g14360

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g14360

Limit To All Plant Sequences

>Glyma06g14360.1   sequence type=CDS   gene model=Glyma06g14360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGACGATCTTGTCGTCTGAGACCATGAATATTCCCGACGGCGTGAGCATCAAGGTTCACGCTAAGGTTATCGAGGTTGAGGGCCCTCGTGGAAAACTCGTGCGAGACTTCCACCATCTGAACTTGGACTTCCAACTTATTACCGACGATGGCGGTAAAAGGAAGCTCAAGATTGATTCTTGGTTTGGTTCTCGTAAAACCTCCGCCGCCATCCGCACCGCCCTCAGCCACGTTGAGAATTTGATCACCGGCGTCACCAAGGGATACCGATACAAAATGAGATTCGTGTACGCTCATTTTCCTATCAACGCTAGCATTGGCAACAACAGCAAGTCCATCGAGATCAGAAATTTCCTCGGCGAGAAGAAGGTGAGGAAAGTGGACATGCTTGAGGGCGTGTCGGTTGTTAGATCTGAAAAGGTCAAAGATGAATTGGTCTTGGATGGAAACGACATTGAACTTGTTTCTAGGTCATGTGCTCTCATTAACCAGAAATGTCATGTTAAGAACAAGGATATCCGGAAGTTTCTTGATGGTATTTATGTAAGCGAGAAGGGAACAATATTGGAAGAGTAG

Predicted protein sequences of Glyma06g14360

Limit To All Plant Sequences

>Glyma06g14360.1   sequence type=predicted peptide   gene model=Glyma06g14360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTILSSETMNIPDGVSIKVHAKVIEVEGPRGKLVRDFHHLNLDFQLITDDGGKRKLKIDSWFGSRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPINASIGNNSKSIEIRNFLGEKKVRKVDMLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKNKDIRKFLDGIYVSEKGTILEE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain