Report for Sequence Feature Glyma06g14330
Feature Type: gene_model
Chromosome: Gm06
Start: 11275891
stop: 11276982
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g14330
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G33140 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein L6 family | chr1:12023360-12024502 FORWARD LENGTH=194
SoyBase E_val: 2.00E-119 ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0009955 GO-bp
Annotation by Michelle Graham. GO Biological Process: adaxial/abaxial pattern specification
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005773 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuole
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0015934 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0022625 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
GO:0019843 GO-mf
Annotation by Michelle Graham. GO Molecular Function: rRNA binding
SoyBase N/A ISS
KOG3255
KOG
60S ribosomal protein L9
JGI ISS
PTHR11655 Panther
60S RIBOSOMAL PROTEIN L9 FAMILY MEMBER
JGI ISS
PTHR11655:SF2 Panther
50S RIBOSOMAL PROTEIN L6
JGI ISS
PF00347 PFAM
Ribosomal protein L6
JGI ISS
UniRef100_C6TJH2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJH2_SOYBN
SoyBase E_val: 3.00E-136 ISS
UniRef100_G7J9M6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L9 n=1 Tax=Medicago truncatula RepID=G7J9M6_MEDTR
SoyBase E_val: 6.00E-123 ISS
Expression Patterns of Glyma06g14330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g14330
Paralog Evidence Comments
Glyma04g40470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g14330 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g138400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g14330
Coding sequences of Glyma06g14330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g14330.1 sequence type=CDS gene model=Glyma06g14330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGACGATTCTATCGTCCGAGACCATGAATATTCCCGACGGCGTGAGCATCAAGGTTCACGCTAAGGTTATCGAGGTTGAGGGCCCTCGTGGAAAACTCGTGCGAGACTTCCACCATCTGAACTTGGACTTCCAACTTATTACCGACGATGGCGGTAAAAGGAAGCTCAAGATTGATTCTTGGTTTGGTTCTCGTAAAACCTCCGCCGCCATCCGCACCGCCCTCAGCCACGTTGAGAATTTGATCACCGGCGTCACCAAGGGATACCGATACAAAATGAGATTCGTGTACGCTCATTTTCCGATCAACGCTAGCATTGGCAACAACAGCAAGTCCATCGAGATCAGAAATTTCCTCGGCGAGAAGAAGGTGAGGAAAGTAGACATGCTTGAGGGCGTGTCGGTTGTTAGATCTGAAAAGGTCAAAGATGAATTGGTCTTGGATGGAAACGACATTGAACTTGTTTCTAGGTCATGTGCTCTCATTAACCAGAAATGTCATGTTAAGAATAAGGATATCCGGAAGTTTCTTGATGGTATTTATGTCAGCGAGAAGGGAACAATATTGGAAGAGTAG
Predicted protein sequences of Glyma06g14330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g14330.1 sequence type=predicted peptide gene model=Glyma06g14330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKTILSSETMNIPDGVSIKVHAKVIEVEGPRGKLVRDFHHLNLDFQLITDDGGKRKLKIDSWFGSRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPINASIGNNSKSIEIRNFLGEKKVRKVDMLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKNKDIRKFLDGIYVSEKGTILEE*