SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g14210

Feature Type:gene_model
Chromosome:Gm06
Start:11205832
stop:11207838
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g14210
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54160AT Annotation by Michelle Graham. TAIR10: O-methyltransferase 1 | chr5:21982075-21984167 FORWARD LENGTH=363 SoyBaseE_val: 0ISS
GO:0006598GO-bp Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009698GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process SoyBaseN/AISS
GO:0009805GO-bp Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process SoyBaseN/AISS
GO:0009809GO-bp Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0042398GO-bp Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process SoyBaseN/AISS
GO:0051555GO-bp Annotation by Michelle Graham. GO Biological Process: flavonol biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0030744GO-mf Annotation by Michelle Graham. GO Molecular Function: luteolin O-methyltransferase activity SoyBaseN/AISS
GO:0030755GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 3-O-methyltransferase activity SoyBaseN/AISS
GO:0033799GO-mf Annotation by Michelle Graham. GO Molecular Function: myricetin 3'-O-methyltransferase activity SoyBaseN/AISS
GO:0047763GO-mf Annotation by Michelle Graham. GO Molecular Function: caffeate O-methyltransferase activity SoyBaseN/AISS
KOG3178 KOG Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases JGI ISS
PTHR11746Panther O-METHYLTRANSFERASE JGI ISS
PF00891PFAM O-methyltransferase JGI ISS
PF08100PFAM Dimerisation domain JGI ISS
UniRef100_F8SMC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase n=1 Tax=Glycine max RepID=F8SMC0_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1KB23UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KB23_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g14210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g14210 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g137200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g14210
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g14210
>Glyma06g14210.1   sequence type=CDS   gene model=Glyma06g14210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTCAACAGGCGAGACTCAGATTACTCCAACTTATGTGTCCGATGAAGAGGCAAACTTATTCGCCATGCAACTAGCCAGTGCCTCTGTACTCCCTATGGTTCTCAAATCAGCTCTTGAACTTGATCTGTTGGAAATCATAGCCAAGGCTGGCCCTGGTGTTCACCTTTCCCCCACTGACATTGCTTCTCAGCTCCCAACACACAATCCTAACGCACCCGTGATGTTGGACCGCATATTGCGGCTCTTGGCTTGCTACAATATCCTTTCTTTTTCTCTTCGCACTCTCCCTGATTGCAAGATTGAGAGGCTCTATGGGCTCGCCCCAGTTGCTAAGTATTTGGTCAAGAATGAAGATGGTGTCTCCATTGCTGCGCTCAACCTCATGAACCAGGACAAAGTCCTCATGGAAAGCTGGTACTATTTGAAAGATGCAGTCCTTGAAGGAGGCATTCCATTTAACAAGGCTTATGGAATGACAGCCTTTGAGTACCATGGAACAGATCCAAGGTTTAACAAGGTTTTCAACAAGGGGATGGCTGATCACTCTACCATCACAATGAAGAAAATTCTTGAGACCTACACAGGTTTTGGCGGTCTTAAATCTCTAGTTGATGTTGGTGGTGGGACTGGAGCGATAATCAACATGATTGTCTCAAAGTATCCCACTATTAAGGGCATTAATTTTGATTTGCCTCATGTCATTGAAGATGCCACATCTTATCCAGGAGTGGAGCATGTCGGCGGAGATATGTTTGTGAGTGTTCCGAAAGCTGATGCTATTTTTATGAAGTGGATTTGCCACGATTGGAGTGATGAGCATTGCTTGAAGTTTTTGAAGAACTGCTATGAGGCACTTCCAGACAATGGGAAGGTGATTGTGGCAGAATGCATTCTTCCGGTGGCTCCAGACTTTAGCTTGGCCACAAAGGGTGTAGTTCACATTGATGTGATCATGTTGGCTCATAATCCAGGTGGAAAAGAGAGAACAGAGAAAGAGTTTGAGGCTTTGGCCAAAGGATCAGGATTCCAAGGTTTCCGAGTCCACTGTTGTGCTTTCAATACCTACGTAATGGAATTTCTCAAAAAGGAGGTTTAA
Predicted protein sequences of Glyma06g14210
>Glyma06g14210.1   sequence type=predicted peptide   gene model=Glyma06g14210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSTGETQITPTYVSDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDIASQLPTHNPNAPVMLDRILRLLACYNILSFSLRTLPDCKIERLYGLAPVAKYLVKNEDGVSIAALNLMNQDKVLMESWYYLKDAVLEGGIPFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKILETYTGFGGLKSLVDVGGGTGAIINMIVSKYPTIKGINFDLPHVIEDATSYPGVEHVGGDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDFSLATKGVVHIDVIMLAHNPGGKERTEKEFEALAKGSGFQGFRVHCCAFNTYVMEFLKKEV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo