Glyma06g14200 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g14200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g14200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g14200

Feature Type:	gene_model
Chromosome:	Gm06
Start:	11198506
stop:	11202049
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g14200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G54160	AT	Annotation by Michelle Graham. TAIR10: O-methyltransferase 1 \| chr5:21982075-21984167 FORWARD LENGTH=363	SoyBase	E_val: 0	ISS
GO:0006598	GO-bp	Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009698	GO-bp	Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process	SoyBase	N/A	ISS
GO:0009805	GO-bp	Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process	SoyBase	N/A	ISS
GO:0009809	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process	SoyBase	N/A	ISS
GO:0009963	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0042398	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0051555	GO-bp	Annotation by Michelle Graham. GO Biological Process: flavonol biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0030744	GO-mf	Annotation by Michelle Graham. GO Molecular Function: luteolin O-methyltransferase activity	SoyBase	N/A	ISS
GO:0030755	GO-mf	Annotation by Michelle Graham. GO Molecular Function: quercetin 3-O-methyltransferase activity	SoyBase	N/A	ISS
GO:0033799	GO-mf	Annotation by Michelle Graham. GO Molecular Function: myricetin 3'-O-methyltransferase activity	SoyBase	N/A	ISS
GO:0047763	GO-mf	Annotation by Michelle Graham. GO Molecular Function: caffeate O-methyltransferase activity	SoyBase	N/A	ISS
KOG3178	KOG	Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases	JGI		ISS
PTHR11746	Panther	O-METHYLTRANSFERASE	JGI		ISS
PF00891	PFAM	O-methyltransferase	JGI		ISS
PF08100	PFAM	Dimerisation domain	JGI		ISS
UniRef100_C6TGR0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TGR0_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_F8SMC0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase n=1 Tax=Glycine max RepID=F8SMC0_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g14200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g14200 not represented in the dataset	Glyma06g14200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g14200 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g137100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g14200

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g14200

Limit To All Plant Sequences

>Glyma06g14200.1   sequence type=CDS   gene model=Glyma06g14200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTCAACAGGTGAGACTCAGATTACCCCAACCCACGTATCTGATGAAGAAGCAAACCTTTTCGCCATGCAACTAGCCAGTGCTTCTGTCCTTCCAATGATCCTCAAATCAGCACTTGAGCTTGATCTGTTGGAAATCATAGCCAAGGCTGGCCCTGGTGTTCATCTTTCCCCCACTGACATTTCTTCTCAGCTCCCAACACAGAACCCTGATGCACCCGTTATGTTGGACCGTATATTGCGCCTATTGGCTTGCTACAATATCCTCTCTTTTTCTCTCCGCACTCTCCCTGATGGCAAGGTTGAGAGGCTCTATGGTCTCGCCCCCGTTGCCAAGTACTTGGTTAAGAACGAAGATGGTGTCTCCATTGCTGCGCTCAACCTCATGAACCAGGACAAAGTCCTCATGGAAAGCTGGTACTATTTGAAAGATGCAGTCCTTGAAGGAGGCATTCCATTTAACAAGGCTTATGGAATGACAGCCTTTGAGTACCATGGAACAGATCCAAGGTTTAACAAGGTTTTCAACAAGGGAATGGCTGATCACTCTACCATCACAATGAAGAAAATTCTTGAGACCTACACAGGTTTTGAGAGTCTTAAATCTCTGGTTGATGTTGGTGGTGGGACTGGAGCTGTAATCAACATGATTGTCTCAAAGCATCCCACTATTAAGGGCATTAATTTTGATTTGCCTCATGTCATTGAAGATGCCCCATCTTATCCTGGAGTGGAGCATGTAGGTGGAGATATGTTTGCGAGTGTTCCGAAAGCTGATGCTATTTTTATGAAGTGGATTTGCCACGATTGGAGTGATGAGCACTGCTTGAAGTTTTTGAAGAACTGCTACGAGGCACTACCAGACAATGGGAAGGTGATTGTGGCAGAATGCATTCTTCCAGTGGCTCCAGACTCTAGCTTGGCCACAAAAGGTGTGGTTCACATCGATGTGATCATGTTGGCACATAATCCAGGTGGGAAAGAGAGAACAGAGAAAGAGTTTGAGGCTCTGGCCAAAGGGTCTGGATTCCAAGGTTTCCGAGTTGTTTGCTGTGCTTTCAATACCAACATCATGGAATTTCTCAAAAAGATTTAA

Predicted protein sequences of Glyma06g14200

Limit To All Plant Sequences

>Glyma06g14200.1   sequence type=predicted peptide   gene model=Glyma06g14200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSTGETQITPTHVSDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSPTDISSQLPTQNPDAPVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQDKVLMESWYYLKDAVLEGGIPFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKILETYTGFESLKSLVDVGGGTGAVINMIVSKHPTIKGINFDLPHVIEDAPSYPGVEHVGGDMFASVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCCAFNTNIMEFLKKI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain