SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g14100

Feature Type:gene_model
Chromosome:Gm06
Start:11128882
stop:11129356
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g14100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_I1KB11UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KB11_SOYBN SoyBaseE_val: 9.00E-40ISS

Expression Patterns of Glyma06g14100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g14100 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g136000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g14100
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g14100
>Glyma06g14100.1   sequence type=CDS   gene model=Glyma06g14100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCATGTCTCTCTTCAGCCACTTCGACATCGCGCATGGACAGAAGTGGAGATTTTCCTTTCCCTCCACCGAGTCGAAAACCACCAGAAAAGATTCGAATGGATCATCACCCGTAGGACCCAAGCAAAACCCGCCCAGGTTTGCGCCGGAGTTGGATGGCTTGCACTGCTTTGAATCCATCGTACCCTGTTAG
Predicted protein sequences of Glyma06g14100
>Glyma06g14100.1   sequence type=predicted peptide   gene model=Glyma06g14100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFMSLFSHFDIAHGQKWRFSFPSTESKTTRKDSNGSSPVGPKQNPPRFAPELDGLHCFESIVPC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo