Glyma06g14090 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g14090

Feature Type:	gene_model
Chromosome:	Gm06
Start:	11126620
stop:	11127561
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g14090

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G54165	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). \| chr5:21984620-21984868 FORWARD LENGTH=82	SoyBase	E_val: 8.00E-10	ISS
UniRef100_I1KB10	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KB10_SOYBN	SoyBase	E_val: 2.00E-53	ISS

Expression Patterns of Glyma06g14090

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g14090

Paralog	Evidence	Comments
Glyma04g40700	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g14090 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g135900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g14090

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g14090

Limit To All Plant Sequences

>Glyma06g14090.1   sequence type=CDS   gene model=Glyma06g14090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGTCCATCTTCAGCCACTTCGAGATCGCGCAGGCCCAGAACTGGAGCTTTTCTTTGCTCCCAGTAAAAAGCACGAATTCGAAGCCCAACACAGAAGCCACTTCCTCCTCCGCTGAGTCCAAAACCGCCAGAAAAGTTTCCAATCTATCACAACCCGGTGGATCCAAGCAAAACCCGCCCCGTTTGAGGCCCAGATTTGCGCCGGAGTTGGACGGGTTACACTGCTTTGAATCCATTGTACCCTGCTAG

Predicted protein sequences of Glyma06g14090

Limit To All Plant Sequences

>Glyma06g14090.1   sequence type=predicted peptide   gene model=Glyma06g14090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMSIFSHFEIAQAQNWSFSLLPVKSTNSKPNTEATSSSAESKTARKVSNLSQPGGSKQNPPRLRPRFAPELDGLHCFESIVPC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain