SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g13940

Feature Type:gene_model
Chromosome:Gm06
Start:11018987
stop:11022250
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g13940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G00850AT Annotation by Michelle Graham. TAIR10: GRF1-interacting factor 3 | chr4:357675-358928 FORWARD LENGTH=223 SoyBaseE_val: 3.00E-20ISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003713GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription coactivator activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF05030PFAM SSXT protein (N-terminal region) JGI ISS
UniRef100_G7J885UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calcium-responsive transactivator n=1 Tax=Medicago truncatula RepID=G7J885_MEDTR SoyBaseE_val: 3.00E-27ISS
UniRef100_I1KAZ4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KAZ4_SOYBN SoyBaseE_val: 5.00E-136ISS

Expression Patterns of Glyma06g13940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g13940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g134400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g13940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g13940
>Glyma06g13940.1   sequence type=CDS   gene model=Glyma06g13940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCAACGCTGATCCTTCATTTCCCAGTGTCCCTACCCTCACCACTGAACAGATTCAAAAGTACTTGGAGGAGAATAAGGAGCTGATCCTGGCAATATTGGAACATCAAAACATGGGAAAGTTCACTGAGATTGCACAATGTCAAGCCAAGCTTCAGCATAACTTGACTTTTCTGGCCAAACTTGCGGATGCTGGGTCTCAGACACCAACACCAACACCATTGCCAGCACCGACACCTTCTCAGGTTTCCCAGCAGGCTATTATGCAACAGGGGCAAGGTATGCAACAACCTCAAGTTGCAAATCAGCCACAACCAGATCTTTCTGCATTGAACTTGCCCTTGGAGATGAATGATCAGCAACAGCTGCAGCAGCATCAGCATCTGGCAATGTCATTGCAGATGAATGAGCAAAACTATCAGCTGCCACATTTCCTCTACCAACAACAAATTATCCCTGGATCAATGGGTGGCTTTCCTGTTGCTAATAGTGGCTTATATCAGGCCTCTCAAACCAGACTCAGTAATCTGTCAGAAACACCATCAAGCTACCAAACTGGCTCAGATTCTGGTCCTGGCTGGTCTTAG
Predicted protein sequences of Glyma06g13940
>Glyma06g13940.1   sequence type=predicted peptide   gene model=Glyma06g13940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFNADPSFPSVPTLTTEQIQKYLEENKELILAILEHQNMGKFTEIAQCQAKLQHNLTFLAKLADAGSQTPTPTPLPAPTPSQVSQQAIMQQGQGMQQPQVANQPQPDLSALNLPLEMNDQQQLQQHQHLAMSLQMNEQNYQLPHFLYQQQIIPGSMGGFPVANSGLYQASQTRLSNLSETPSSYQTGSDSGPGWS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo