SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g13720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g13720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g13720

Feature Type:gene_model
Chromosome:Gm06
Start:10839117
stop:10843102
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09150AT Annotation by Michelle Graham. TAIR10: pseudouridine synthase and archaeosine transglycosylase (PUA) domain-containing protein | chr1:2946599-2948908 FORWARD LENGTH=181 SoyBaseE_val: 4.00E-112ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
KOG2523 KOG Predicted RNA-binding protein with PUA domain JGI ISS
PTHR22798Panther MCT-1 PROTEIN JGI ISS
PF01472PFAM PUA domain JGI ISS
UniRef100_C6SVY0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVY0_SOYBN SoyBaseE_val: 5.00E-130ISS
UniRef100_G7J7I4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Malignant T cell-amplified sequence 1-A n=1 Tax=Medicago truncatula RepID=G7J7I4_MEDTR SoyBaseE_val: 5.00E-125ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g13720 not represented in the dataset

Glyma06g13720 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g41130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g132000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g13720.1   sequence type=CDS   gene model=Glyma06g13720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCAAAAAATTTTCTGGCGAAGATGTGTCTGCACAGAACCAAGTGAAGGCATCTGTTCAACGAAAAATACGACAAAGTATTGCTGAAGAGTATCCGGGCCTTGAACCTGTTTTGGATGATATACTTCCCAAGAAGTCCCCTCTTATAGTTGCTAAATGTCAGAACCATCTCAATCTGGTTCTTGTGAACAACGTGCCTTTGTTTTTCAGTGTCCGTGATGGACCATACATGCCCACCTTGCGACTTCTCCATCAATATCCAAATATAATGAAAAAGTTACAAGTTGACCGTGGTGCAATTAGATTTGTCTTGGCGGGTGCGAACATAATGTGTCCCGGTCTTACATCTCCTGGGGGTGTTTTGGATGAGGATGTAGGGGCAGAATGCCCTGTGGCCATCATGGCTGAAGGTAAACAGCATGCTCTTGCTATTGGCTTTACAAAAATGTCTGCAAAAGACATAAAAGCAATCAATAAGGGAATTGGGGTTGATAACTTGCATTATCTCAATGATGGTCTTTGGAAGATGGAGAAACTTGATTAA

>Glyma06g13720.1   sequence type=predicted peptide   gene model=Glyma06g13720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFKKFSGEDVSAQNQVKASVQRKIRQSIAEEYPGLEPVLDDILPKKSPLIVAKCQNHLNLVLVNNVPLFFSVRDGPYMPTLRLLHQYPNIMKKLQVDRGAIRFVLAGANIMCPGLTSPGGVLDEDVGAECPVAIMAEGKQHALAIGFTKMSAKDIKAINKGIGVDNLHYLNDGLWKMEKLD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo