SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g13640

Feature Type:gene_model
Chromosome:Gm06
Start:10758396
stop:10761036
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g13640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53490AT Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chr5:21723488-21724621 REVERSE LENGTH=235 SoyBaseE_val: 1.00E-99ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00805PFAM Pentapeptide repeats (8 copies) JGI ISS
UniRef100_B9SJT2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid lumenal 17.4 kDa protein, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9SJT2_RICCO SoyBaseE_val: 4.00E-106ISS
UniRef100_I1KAV5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KAV5_SOYBN SoyBaseE_val: 1.00E-174ISS

Expression Patterns of Glyma06g13640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g13640
ParalogEvidenceComments
Glyma04g41210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g13640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g131300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g13640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g13640
>Glyma06g13640.1   sequence type=CDS   gene model=Glyma06g13640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAATGTTTCAATTCCACTCCCACGAAACGGTTTCTCCAAACCCAATTACTCGACAAAACGCCCATGTTTCACCCCTTCAGCTTCAACACTCAGAATTTCTTGCTCTGGAGTGGCTGAGTTTGATGGATCTCATCAGAAAAAAGGAGGTTTGTTTAATTTCAATGGAATCAAGGGCGTGGCTTGTGGTATTCTTGCAGCTTGTGCTGTTACTTCTGCTGCATTTCCTGTTACTGCTGCTACTCAGAGGCTTCCCCCATTGTCAACTGAGCCCAATCGCTGTGAGCGTGCATTTGTTGGCAACACAATTGGTCAGGCAAATGGTGTATATGATAAACCATTAGATCTCCGGCAATGTGATTTCACAAATGAGAAAACCAACCTTAAGGGGAAGTCCCTGTCTGCTGCACTCATGTCAGATGCTAAGTTTGATGGAGCTGATATGACAGAAGTTGTAATGTCAAAGGCTTATGCTGCTGGTGCCAGCTTTAAAGGGGTGGACTTCTCAAATGCAGTCTTGGACCGTGTGAACTTTGAGAAAGCTGATCTTGAAGGAGCTATATTTAAGAACACGGTATTGTCAGGATCCACCTTTGATGATGCTAAGCTGGACAATGCAGTTTTCGAGGACACTATCATTGGTTACATTGATCTCCAGAAACTATGCACAAATAAGACCATTGGTGATGAATGGAGAGTTGAACTAGGATGTCGATGA
Predicted protein sequences of Glyma06g13640
>Glyma06g13640.1   sequence type=predicted peptide   gene model=Glyma06g13640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANVSIPLPRNGFSKPNYSTKRPCFTPSASTLRISCSGVAEFDGSHQKKGGLFNFNGIKGVACGILAACAVTSAAFPVTAATQRLPPLSTEPNRCERAFVGNTIGQANGVYDKPLDLRQCDFTNEKTNLKGKSLSAALMSDAKFDGADMTEVVMSKAYAAGASFKGVDFSNAVLDRVNFEKADLEGAIFKNTVLSGSTFDDAKLDNAVFEDTIIGYIDLQKLCTNKTIGDEWRVELGCR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo