SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g13460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g13460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g13460

Feature Type:gene_model
Chromosome:Gm06
Start:10598242
stop:10600350
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G49250AT Annotation by Michelle Graham. TAIR10: defective in meristem silencing 3 | chr3:18258613-18260803 REVERSE LENGTH=420 SoyBaseE_val: 4.00E-105ISS
GO:0000724GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination SoyBaseN/AISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0016444GO-bp Annotation by Michelle Graham. GO Biological Process: somatic cell DNA recombination SoyBaseN/AISS
GO:0016569GO-bp Annotation by Michelle Graham. GO Biological Process: covalent chromatin modification SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q94A79UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g49250/F2K15_110 n=1 Tax=Arabidopsis thaliana RepID=Q94A79_ARATH SoyBaseE_val: 2.00E-102ISS
UniRef100_UPI00023395F4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023395F4 related cluster n=1 Tax=unknown RepID=UPI00023395F4 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g13460 not represented in the dataset

Glyma06g13460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g41390 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g129200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g13460.2   sequence type=CDS   gene model=Glyma06g13460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CATTCCCTTCATACAAATCCACTATCCATCCAAGGAGCTTCTTCAGCACTGGTGCCAGTGGATTTGAATGAAGGCACTGTTGATGCAAAGGAAAATAAACTGGAAGATGATCTACGCATGTTAGGGACGAAAATTAAGCAGCATGAGAACAACCTATATCATTTGAACTCTGAAAAAAGCAAATTAGATGACTCCATTCTTCATTTGCAAGTTACTATTGGGAAATCAGATTCTTCAAGTAAGGCCACAATTGGTGATATGGACAATCCCAACCCTACAAATGATGAGGAAGTGAATAAACAGATATTGCAGCATGAAAAATCTGCTGCTGGTATTTTGTGCCAGCTTAGGATTCATCATGGAGCTCAGGCTTCTCATCTTACATTGACAAAGGATGTTGTGGGTATTGTTGCTACTCTGGGCAAAGTTGAGGATGACATTCTTAGCAGACTTTTCTCAGAGTATCTAGGAGTGGAGACTATGCTGGCAATTGTTTGCAGAACTTATGAAGAGGTTAAAGCTCTTGAAATGTATGATAAGGAAGGATGCATAAATAAAAGTTTTGATCTTCGTAGGCTAGGTGCCTCTATTGGAAGGGCTTTGGATGGCATGCCTTCTAGAGTCTTGTGTTTATGCCTTTCATTTGTGGTTGTGGATAAGCCTTATGCTGGTAATTACATGCTTGAGGATGCACAACGGAAGTTGGATATTTTAATCCCAAGATTGCCCAATGGGGAGCTTCCATCTGGATTTCTTGGTTATGCAGTGACTATGATTAATTTAGATAGCTCAAACCTATTTTGTGTTACTCCCAGTGGTTATGGCCTCAGAGAAACTCTGTTTTATAATCTCTTTTCTTGTCTACAAGTATATAAGACAAGGGCTAAAATGATACAAGCACTTCCTTGCATAAGTGAAGGAGCTCTTTCTTTAGATGGAGGAATGGTTAGGAGTTGTGGTGTATTTTCCTTGGGCAATAGCTAA

>Glyma06g13460.2   sequence type=predicted peptide   gene model=Glyma06g13460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
HSLHTNPLSIQGASSALVPVDLNEGTVDAKENKLEDDLRMLGTKIKQHENNLYHLNSEKSKLDDSILHLQVTIGKSDSSSKATIGDMDNPNPTNDEEVNKQILQHEKSAAGILCQLRIHHGAQASHLTLTKDVVGIVATLGKVEDDILSRLFSEYLGVETMLAIVCRTYEEVKALEMYDKEGCINKSFDLRRLGASIGRALDGMPSRVLCLCLSFVVVDKPYAGNYMLEDAQRKLDILIPRLPNGELPSGFLGYAVTMINLDSSNLFCVTPSGYGLRETLFYNLFSCLQVYKTRAKMIQALPCISEGALSLDGGMVRSCGVFSLGNS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo