SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g13150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g13150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g13150

Feature Type:gene_model
Chromosome:Gm06
Start:10296040
stop:10298007
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g13150
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53160AT Annotation by Michelle Graham. TAIR10: regulatory components of ABA receptor 3 | chr5:21561026-21561953 FORWARD LENGTH=188 SoyBaseE_val: 9.00E-101ISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009789GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF10604PFAM Polyketide cyclase / dehydrase and lipid transport JGI ISS
UniRef100_G7J6S4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Abscisic acid receptor PYL8 n=1 Tax=Medicago truncatula RepID=G7J6S4_MEDTR SoyBaseE_val: 1.00E-115ISS
UniRef100_I1KAN9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KAN9_SOYBN SoyBaseE_val: 8.00E-137ISS

Expression Patterns of Glyma06g13150
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g13150 not represented in the dataset
Glyma06g13150 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g13150 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g126100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g13150
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g13150
>Glyma06g13150.1   sequence type=CDS   gene model=Glyma06g13150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGAGTTGAGCAGCAGAGAGGTGGAATACATAAGGAGACACCACAGCAAGGCAGCAGAGGACAATCAGTGTGCCTCTGCTCTCGTTAAGCACATAAGGGCCCCACTTCCTCTCGTGTGGTCGTTGGTGAGGAGATTTGATGAGCCGCAGAAGTATAAACCGTTTGTGAGCAGGTGCGTGGTGAGGGGAAACCTTGAGATTGGGAGTTTGAGAGAGGTTGATGTTAAGTCCGGCCTTCCAGCGACTACTAGTACTGAAAGATTAGAGATTCTTGATGACAATCATCATATACTTAGCGTCAGGATTATTGGCGGTGATCATAGACTTAGGAACTACTCGTCTATCATGTCCCTCCACCCAGAAATTGTTGATGGAAGGCCAGGTACCCTGGTAATTGAATCATTTGTGGTGGACATACCTGAAGGCAACACCAAGGATGAGACCTGCTACTTCGTTGAAGCATTGATCAAATGCAATCTCAAATCACTTGCTGATGTCTCAGAAGGCCTTACTTTGCAGGACCACACTGAACCAATTGATCGAAAATACGAGTTATTGATCACAAGAGGCTGA
Predicted protein sequences of Glyma06g13150
>Glyma06g13150.1   sequence type=predicted peptide   gene model=Glyma06g13150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTELSSREVEYIRRHHSKAAEDNQCASALVKHIRAPLPLVWSLVRRFDEPQKYKPFVSRCVVRGNLEIGSLREVDVKSGLPATTSTERLEILDDNHHILSVRIIGGDHRLRNYSSIMSLHPEIVDGRPGTLVIESFVVDIPEGNTKDETCYFVEALIKCNLKSLADVSEGLTLQDHTEPIDRKYELLITRG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo