Report for Sequence Feature Glyma06g12440
Feature Type: gene_model
Chromosome: Gm06
Start: 9616427
stop: 9619325
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g12440
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G08455 AT
Annotation by Michelle Graham. TAIR10: BTB/POZ domain-containing protein | chr4:5375891-5376922 FORWARD LENGTH=243
SoyBase E_val: 9.00E-92 ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
PTHR26379 Panther
FAMILY NOT NAMED
JGI ISS
PTHR26379:SF191 Panther
JGI ISS
PF00651 PFAM
BTB/POZ domain
JGI ISS
UniRef100_B9S2S7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9S2S7_RICCO
SoyBase E_val: 2.00E-93 ISS
UniRef100_I1KAF5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KAF5_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g12440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g12440
Paralog Evidence Comments
Glyma04g42350 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g12440 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g118200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g12440
Coding sequences of Glyma06g12440
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g12440.1 sequence type=CDS gene model=Glyma06g12440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
AGGAGCGTGCGTGAGAGACAGCACATCATGGTACGGAATCGGAGAAGGATGCCTCCGCGGCGGTGCACGGCGTCTATGGGCAGCAGCAACGGGAGCGAGAGCGATGCGTCAGACTTGGTGATGCGGTGCCTCTCGTGCGAGGAGGAATACGACATGGACGACTCGGGAACCTGCAGGGAGTGCTACCAGGAGGCCAACGAGGCTGAGGAGGAGCTCCGCCGCGAGATCGAAGAGCTCAAATCCAAAGTCTCCTTCCTCACTCTCCCCTATCCCAATCTAAACGCTTCCACCGCCGATATCATCCTCGTTCCCGTCGACGACTCCGACGCCGTTCCCATTCCCGCTCACAAGCACCTTCTGGTTAGTCGCTCTCCTGTTTTCAAAGCAATGCTTGAGAACGATATGGCAGAAAGGCGGAGTGGCACCATCAAGATTTCTGACATATCATATGATACCCTTAGTGCTTTTGTTAATTATTTATACACTGCTGAAGCGTCCCTTGATAACGAATTGGCCTGTAACCTGTTGGTTTTAGGAGAAAAGTATCAGGTGAAGCATCTCAAGACATATTGTGAAAAGTATTTGATCGCCAAAATGAATTGGAATAAAGCTATTTCTAACTATGCCTTTGCATATCAATACAATTGCAAACAATTACGAAGTGCGTCCTTGGCAGTGATCTTGGACAACATGGACCTGCTCACTCAAAATGAATGTTATGCGGAGCTGGTGGACACTAATCCTCGTCTTGTTGTGGAAATATATGAAACATATATCGGCAAGCAATTAAATACTGCAGGCGCATTTTAG
Predicted protein sequences of Glyma06g12440
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g12440.1 sequence type=predicted peptide gene model=Glyma06g12440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
RSVRERQHIMVRNRRRMPPRRCTASMGSSNGSESDASDLVMRCLSCEEEYDMDDSGTCRECYQEANEAEEELRREIEELKSKVSFLTLPYPNLNASTADIILVPVDDSDAVPIPAHKHLLVSRSPVFKAMLENDMAERRSGTIKISDISYDTLSAFVNYLYTAEASLDNELACNLLVLGEKYQVKHLKTYCEKYLIAKMNWNKAISNYAFAYQYNCKQLRSASLAVILDNMDLLTQNECYAELVDTNPRLVVEIYETYIGKQLNTAGAF*