SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g12420

Feature Type:gene_model
Chromosome:Gm06
Start:9601267
stop:9603141
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G37925AT Annotation by Michelle Graham. TAIR10: subunit NDH-M of NAD(P)H:plastoquinone dehydrogenase complex | chr4:17830748-17831485 REVERSE LENGTH=217 SoyBaseE_val: 4.00E-91ISS
GO:0010258GO-bp Annotation by Michelle Graham. GO Biological Process: NADH dehydrogenase complex (plastoquinone) assembly SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0010598GO-cc Annotation by Michelle Graham. GO Cellular Compartment: NAD(P)H dehydrogenase complex (plastoquinone) SoyBaseN/AISS
GO:0016655GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor SoyBaseN/AISS
PF10664PFAM Cyanobacterial and plastid NDH-1 subunit M JGI ISS
UniRef100_A7NVJ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit M, chloroplastic n=1 Tax=Vitis vinifera RepID=NDHM_VITVI SoyBaseE_val: 6.00E-112ISS
UniRef100_I1KAF2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KAF2_SOYBN SoyBaseE_val: 1.00E-163ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g42380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g118000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g12420.1   sequence type=CDS   gene model=Glyma06g12420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACAAGTTGCTCCTACATGGTTTCCACCAAATTATCCATGCTAGGCTGGAGTGGAGGAAGAAGAAGAGAAGCGAGAAACCGGAGAGCATTCTTGGTCTCAGCTCAACAACAAAGTGATGTTCAGGAAGCAGAGAGCGTGAAGGTAGTAGAAGAGGAGAAGGAGCAAGAACAAGTGCAAACCCAAACACCAAAGCCAAAAGGAACAACACCAAGGCCAGTGGAACCTCAGTTGAATGTGAAGAGCAAGAACATGTTGAGGGAATATGGAGGGCAGTGGCTGAGCTGCGCCACTCGCCATGTGAGGATCTATGCAGCGTATATCGATCCGGTGACTTGTGAGTTTGATCAAACCCAGATGGATAAGCTCACCCTTATTCTTGATCCCACTGATGAGTTTGTGTGGAATCCTGAGACTTGCAACATGGTCTATTCTTACTTCCAGGAGCTTGTTGATCACTACGAGGGTGCTCCATTGACAGAATACACACTTCGCCTGATTGGTTCAGACATAGAGCACTATATAAGAAAAATGTTATACGATGGGGTAATCAAGTATAACATGAATGCAAGGGTTCTGAATTTCAGCATGGGAAAGCCAAGGATCATGTTCAACAACAATGATATCCAACCTGAAGATGCAATTGAGAAATGA

>Glyma06g12420.1   sequence type=predicted peptide   gene model=Glyma06g12420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATSCSYMVSTKLSMLGWSGGRRREARNRRAFLVSAQQQSDVQEAESVKVVEEEKEQEQVQTQTPKPKGTTPRPVEPQLNVKSKNMLREYGGQWLSCATRHVRIYAAYIDPVTCEFDQTQMDKLTLILDPTDEFVWNPETCNMVYSYFQELVDHYEGAPLTEYTLRLIGSDIEHYIRKMLYDGVIKYNMNARVLNFSMGKPRIMFNNNDIQPEDAIEK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo