SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g12301

Feature Type:gene_model
Chromosome:Gm06
Start:9480568
stop:9484870
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g12301
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G77350AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function KRTCAP2 (InterPro:IPR018614); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr1:29070497-29071 SoyBaseE_val: 2.00E-56ISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4615 KOG Uncharacterized conserved protein JGI ISS
PF09775PFAM Keratinocyte-associated protein 2 JGI ISS
UniRef100_B6SJ34UniRef Annotation by Michelle Graham. Most informative UniRef hit: Keratinocytes-associated protein 2 n=2 Tax=Andropogoneae RepID=B6SJ34_MAIZE SoyBaseE_val: 3.00E-46ISS
UniRef100_C6T3F8UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T3F8_SOYBN SoyBaseE_val: 1.00E-80ISS

Expression Patterns of Glyma06g12301
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g12301 not represented in the dataset
Glyma06g12301 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g12301
ParalogEvidenceComments
Glyma04g42480 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g12301 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g116700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g12301
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g12301
>Glyma06g12301.1   sequence type=CDS   gene model=Glyma06g12301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGGTCTGGGAGTTCCATGCTGTATTCCTTTCTTCTCTTCACAGTCATTCTCTCACTTCAAGAAATGTACCGAGGGAAACTAGCATCATCAGAATTATACACTATACTTGGAGGGTTTGTTAGCTCTATCCTATTTCTTGTGCTCCTAACCTTCATTGGAAATTTGCAGGAAACAATTGGTGCAAGAACTGGTTGGGGAGCTGTCATAGTTGCAGAAGCAGTTGCTCTGATTGCTGCAAGCACTGTCCACCGAGTTTGCATCACTACATGTTTCCTGTTCTCGGCTGCATTGCTGTATGAAGTTAACAAGATCTCTGGGTCAGCGCTTTCAACAAGTGACTCCAGGATTAAAAAGCAAAGTGGAAGAGCTTAA
Predicted protein sequences of Glyma06g12301
>Glyma06g12301.1   sequence type=predicted peptide   gene model=Glyma06g12301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGSGSSMLYSFLLFTVILSLQEMYRGKLASSELYTILGGFVSSILFLVLLTFIGNLQETIGARTGWGAVIVAEAVALIAASTVHRVCITTCFLFSAALLYEVNKISGSALSTSDSRIKKQSGRA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo