SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g12181

Feature Type:gene_model
Chromosome:Gm06
Start:9404463
stop:9407372
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G14710AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Proteasome assembly chaperone 3 (InterPro:IPR018788); Has 120 Blast hits to 120 proteins in 47 species: Archae - 0; Bacteria - 0; Metazoa - 62; Fungi - 2; Plants - 49; Viruses - 0; Other Eukaryotes - 7 (source: NCBI BLink). | chr5:4746465-4747776 FORWARD LENGTH=124 SoyBaseE_val: 1.00E-52ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4828 KOG Uncharacterized conserved protein JGI ISS
PF10178PFAM Uncharacterised conserved protein (DUF2372) JGI ISS
UniRef100_G7J4Z4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proteasome assembly chaperone n=1 Tax=Medicago truncatula RepID=G7J4Z4_MEDTR SoyBaseE_val: 1.00E-69ISS
UniRef100_UPI0002339310UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339310 related cluster n=1 Tax=unknown RepID=UPI0002339310 SoyBaseE_val: 6.00E-88ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g12181 not represented in the dataset

Glyma06g12181 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g42580 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g115700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g12181.1   sequence type=CDS   gene model=Glyma06g12181   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATACAGATAGCAGCACTTCACAATTCCCTGTGTCGCAACTCAATTTCTCTCGCCAAATCAAGGGAAATGAAACAGAGATAATCATTTCGAGATACGAAGATCATTTTATGGTTATTGCCACTCAAATAGGAACCCTGGGGACAATAATGTATGCTAGAAAGGAAGAAGGGGTGTCAATTAATCCAACATTCAACGTTTCTGTTATATTTGGCAAACGGGATGAGCCAATGTTAGTAGCATGTGCACGCCAGATGATTGAGCACATGAGTTTGTCTGGCTCCTCCAGGCCATTGGTGCTCTCACTTGGTCTTAAAGACCATTCTGTGGAGACATTGAAAGGCATTGTTTCTGCTGTGATGGACAATAACATGTGGTAA

>Glyma06g12181.1   sequence type=predicted peptide   gene model=Glyma06g12181   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNTDSSTSQFPVSQLNFSRQIKGNETEIIISRYEDHFMVIATQIGTLGTIMYARKEEGVSINPTFNVSVIFGKRDEPMLVACARQMIEHMSLSGSSRPLVLSLGLKDHSVETLKGIVSAVMDNNMW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo