Report for Sequence Feature Glyma06g11980
Feature Type: gene_model
Chromosome: Gm06
Start: 9236075
stop: 9243905
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g11980
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G77470 AT
Annotation by Michelle Graham. TAIR10: replication factor C subunit 3 | chr1:29112194-29114323 REVERSE LENGTH=369
SoyBase E_val: 0 ISS
GO:0000398 GO-bp
Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome
SoyBase N/A ISS
GO:0006260 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA replication
SoyBase N/A ISS
GO:0006312 GO-bp
Annotation by Michelle Graham. GO Biological Process: mitotic recombination
SoyBase N/A ISS
GO:0006346 GO-bp
Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing
SoyBase N/A ISS
GO:0009560 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation
SoyBase N/A ISS
GO:0009909 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of flower development
SoyBase N/A ISS
GO:0016246 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA interference
SoyBase N/A ISS
GO:0016570 GO-bp
Annotation by Michelle Graham. GO Biological Process: histone modification
SoyBase N/A ISS
GO:0031048 GO-bp
Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA
SoyBase N/A ISS
GO:0031348 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response
SoyBase N/A ISS
GO:0048449 GO-bp
Annotation by Michelle Graham. GO Biological Process: floral organ formation
SoyBase N/A ISS
GO:0051567 GO-bp
Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005663 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: DNA replication factor C complex
SoyBase N/A ISS
GO:0000166 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleotide binding
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0016887 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATPase activity
SoyBase N/A ISS
GO:0017111 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity
SoyBase N/A ISS
KOG0990
KOG
Replication factor C, subunit RFC5
JGI ISS
PTHR11669 Panther
REPLICATION FACTOR C / DNA POLYMERASE III GAMMA-TAU SUBUNIT
JGI ISS
PF00004 PFAM
ATPase family associated with various cellular activities (AAA)
JGI ISS
PF08542 PFAM
Replication factor C
JGI ISS
UniRef100_G7J4X7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Replication factor C subunit n=1 Tax=Medicago truncatula RepID=G7J4X7_MEDTR
SoyBase E_val: 0 ISS
UniRef100_I1KAA7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KAA7_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g11980
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g11980
Paralog Evidence Comments
Glyma04g42790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g11980 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g114100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g11980
Coding sequences of Glyma06g11980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g11980.1 sequence type=CDS gene model=Glyma06g11980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGCAGACGACCCATCCCATGGACATCGACGACCACACTTACACCGCCAGTCCTGACAAGGGCAAAAGTGTCGTCTTCGCCGGAAACCCTCCCGCCGCCGGCAAGGCCATTCCGTGGGTCGAAAAATACCGCCCTCAGTCCCTCGACGACGTCGCTGCTCACCGTGACATTGTCGATACAATTGATAGGCTAACCACTGAGAACAGATTGCCCCATCTTCTGTTGTATGGCCCTCCTGGCACGGGCAAAACATCAACGATTCTTGCTGTGGCACGCAAACTGTATGGTTCACAGTACCAAAATATGATTTTGGAGCTCAATGCATCCGATGATAGAGGAATTGATGTCGTGCGCCAGCAGATTCAAGATTTTGCTAGCACTCAGAGCTTATCATTTGGTGTTAAGTCCTCTGTAAAATTGGTATTGTTAGATGAAGCAGATGCCATGACAAAGGATGCCCAATTTGCGCTACGTAGAGTGATTGAGAAATATACAAAAAGCACTAGGTTTGCACTTATCTGTAATCATGTAAACAAGATTATTCCCGCACTTCAATCAAGATGCACTCGGTTTCGGTTTGCCCCTCTTGATGCTGTCCATGTCACTGAAAGACTGAAACATGTTATTAAGGCCGAAGGGCTTGATGTTGAGGACAGTGGCTTAGCAGCTTTTGTTCGGCTTAGCAATGGTGATATGAGAAAGGCTTTGAATATTCTTCAGTCAACACATATGGCTTCTCAGCAGATAACAGAAGAAGCTGTTTACCTGTGCACTGGAAATCCATTGCCAAAAGACATTGAGCTAATATCTTACTGGCTTCTAAATGAACAATTTGCAGATAGCTTTAAAAGAATAGATGAAATGAAGACAAGGAAAGGGTTGGCCCTGATTGATATTGTCAGAGAAGTGACAATGTTTGTTTTTAAGATTAAGATGCCTTCAGCTGTGCGAGTACAGTTGATGAATGATTTGGCAGATATAGAGTACAGATTAAGTTTTGGGTGCAACGATAAGCTTCAGCTTGGATCGGTTATTGCTTCTTTTACACGTGCTAGATCTGCACTGGTTGCAGCTGCTACATAG
Predicted protein sequences of Glyma06g11980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g11980.1 sequence type=predicted peptide gene model=Glyma06g11980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAQTTHPMDIDDHTYTASPDKGKSVVFAGNPPAAGKAIPWVEKYRPQSLDDVAAHRDIVDTIDRLTTENRLPHLLLYGPPGTGKTSTILAVARKLYGSQYQNMILELNASDDRGIDVVRQQIQDFASTQSLSFGVKSSVKLVLLDEADAMTKDAQFALRRVIEKYTKSTRFALICNHVNKIIPALQSRCTRFRFAPLDAVHVTERLKHVIKAEGLDVEDSGLAAFVRLSNGDMRKALNILQSTHMASQQITEEAVYLCTGNPLPKDIELISYWLLNEQFADSFKRIDEMKTRKGLALIDIVREVTMFVFKIKMPSAVRVQLMNDLADIEYRLSFGCNDKLQLGSVIASFTRARSALVAAAT*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
