Glyma06g11785 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g11785

Feature Type:	gene_model
Chromosome:	Gm06
Start:	9072714
stop:	9073856
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g11785

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G08290	AT	Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein \| chr4:5239088-5240861 FORWARD LENGTH=384	SoyBase	E_val: 5.00E-41	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
PF00892	PFAM	EamA-like transporter family	JGI		ISS
UniRef100_G7J315	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4 n=1 Tax=Medicago truncatula RepID=G7J315_MEDTR	SoyBase	E_val: 4.00E-61	ISS
UniRef100_I1KA87	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KA87_SOYBN	SoyBase	E_val: 5.00E-104	ISS

Expression Patterns of Glyma06g11785

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g11785 not represented in the dataset	Glyma06g11785 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g11785

Paralog	Evidence	Comments
Glyma04g42970	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g11785 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g11785

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g11785

Limit To All Plant Sequences

>Glyma06g11785.1   sequence type=CDS   gene model=Glyma06g11785   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCCTGGCCACTTGGATTTGCTTTGTTGGTGCACTTCAAAGTTCTATTGTAGCAGTCTTCGTAGAACGCCACCATCTTCATGCCTGGGCCCTTGGTTGGGATACACGACTCTTTGCTCCTGCTTACGCGGGAATAGTTTCATCTGGAGTTCAATATTACATACAAGGCGTGGTCATAAAACTCATGGGTCCAGTTATTGTGACAGCTTTTAATCCCCTGCGTATGATCATTATTACTACCTTGGCCTGCATAGTCCTATCTGAACAACTCTACCTCGGAAGTATTATTGGAGCAACAGTTGTGGTTCTTGGGCTCTATCTTGTTGTGTGGGGAAAATATAAGGAATGCCACGGAAGATCAATGCCACCGTCCTCTGCAAATGATAACCCTCCAGAAGACCAACGGCAGCTACCGGTCACAGCTACTAGGAATGATAATAAGACTTAA

Predicted protein sequences of Glyma06g11785

Limit To All Plant Sequences

>Glyma06g11785.1   sequence type=predicted peptide   gene model=Glyma06g11785   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLATWICFVGALQSSIVAVFVERHHLHAWALGWDTRLFAPAYAGIVSSGVQYYIQGVVIKLMGPVIVTAFNPLRMIIITTLACIVLSEQLYLGSIIGATVVVLGLYLVVWGKYKECHGRSMPPSSANDNPPEDQRQLPVTATRNDNKT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain