SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g11450

Feature Type:gene_model
Chromosome:Gm06
Start:8803541
stop:8804856
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g11450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G14320AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S13/S18 family | chr5:4617839-4618772 REVERSE LENGTH=169 SoyBaseE_val: 3.00E-80ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3311 KOG Ribosomal protein S18 JGI ISS
PTHR10871Panther 30S/40S RIBOSOMAL PROTEIN JGI ISS
PTHR10871:SF1Panther 30S RIBOSOMAL PROTEIN S13 JGI ISS
PF00416PFAM Ribosomal protein S13/S18 JGI ISS
UniRef100_G7J3M7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S13 n=1 Tax=Medicago truncatula RepID=G7J3M7_MEDTR SoyBaseE_val: 2.00E-89ISS
UniRef100_I1KA54UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KA54_SOYBN SoyBaseE_val: 1.00E-113ISS

Expression Patterns of Glyma06g11450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g11450
ParalogEvidenceComments
Glyma04g43250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g11450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g109300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g11450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g11450
>Glyma06g11450.1   sequence type=CDS   gene model=Glyma06g11450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACAAACGCTGGCAATGCCCGTGGCACCTTCGCTCGCTATCATCTCCAATTCTCGCCTCTCCAAGACACTCTCCGTTCCCGTTCTCAACAACCCAAAGTTTCAAGGGTTAAGCATCAAGTGCGTTCGTGTTGGAGGTGTGGAGATTCCGAACAACAAGCGAATCGAGTACTCGCTGCAGTACATTCATGGAGTTGGCAGGACCAGAGCAAAACAGATTCTGTGTGATATCCAAATGGATAACAAAATCACGAAGGAACTCACTGAGGAGGAGCTCATCACTCTCAGGGACGAAGTCTCCAAATATATGATTGAAGGCGACCTGAGACGGTTCAATGCGGTTAATATAAAGAGACTGAAGGACATTCAGTGCTACAGAGGAATAAGGCACATTCAGGGGCTTCCTTGCAGAGGCCAGCGAACCAAGAACAATTGCAGGACCTTGAAGGGTAAGAAGGTTGCCATTGCCGGCAAAAAGAAAAAGTAA
Predicted protein sequences of Glyma06g11450
>Glyma06g11450.1   sequence type=predicted peptide   gene model=Glyma06g11450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQTLAMPVAPSLAIISNSRLSKTLSVPVLNNPKFQGLSIKCVRVGGVEIPNNKRIEYSLQYIHGVGRTRAKQILCDIQMDNKITKELTEEELITLRDEVSKYMIEGDLRRFNAVNIKRLKDIQCYRGIRHIQGLPCRGQRTKNNCRTLKGKKVAIAGKKKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo