Report for Sequence Feature Glyma06g11090
Feature Type: gene_model
Chromosome: Gm06
Start: 8457074
stop: 8458486
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g11090
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G78020 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF581) | chr1:29338787-29339491 FORWARD LENGTH=162
SoyBase E_val: 4.00E-39 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
PF04570 PFAM
Protein of unknown function (DUF581)
JGI ISS
UniRef100_I1KA17 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KA17_SOYBN
SoyBase E_val: 7.00E-111 ISS
UniRef100_Q9SGZ8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: F28K19.24 n=1 Tax=Arabidopsis thaliana RepID=Q9SGZ8_ARATH
SoyBase E_val: 2.00E-36 ISS
Expression Patterns of Glyma06g11090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g11090
Paralog Evidence Comments
Glyma04g11460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g11090 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g105800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g11090
Coding sequences of Glyma06g11090
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g11090.1 sequence type=CDS gene model=Glyma06g11090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTGTTGGGGAAGAGACCTCGTCCTCCAATTATGAAGAGAACAACAAGCATGTCGGAAATAACCTTCGATCTGAACACGTCCTTGGACGATGATCCGAACAACTCCGTGAAGGGACCAGGAGGAGATGGGCCTCCTGTTGGGCTCAACGGTTTAGATCAGAACAGGGTTTGGGCCATGGTTTCACCCAGAAACCACCATAGAAGGCAATATTCCGAGGATACCCCTGGCTTCTTGCGCGTTTGCTTTCTCTGCAAACGCCGTTTAGTACCCGGCCGTGACATCTTCATGTACAAAGGTGATAGTGCTTTCTGCAGTTCAGAATGCCGTGAACAGCAGATGAAGCATGATGAGAGAAAAGATAAGTGTCGTGTGGCATCATCAAAGAAACAAGTTGCGGCAAAGCCTAATTCTGGGTCTCAAGTTACTACTAATACTAAAGGCGAAACCGTGGTTGCCTTGTAG
Predicted protein sequences of Glyma06g11090
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g11090.1 sequence type=predicted peptide gene model=Glyma06g11090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLLGKRPRPPIMKRTTSMSEITFDLNTSLDDDPNNSVKGPGGDGPPVGLNGLDQNRVWAMVSPRNHHRRQYSEDTPGFLRVCFLCKRRLVPGRDIFMYKGDSAFCSSECREQQMKHDERKDKCRVASSKKQVAAKPNSGSQVTTNTKGETVVAL*