Report for Sequence Feature Glyma06g11081
Feature Type: gene_model
Chromosome: Gm06
Start: 8448115
stop: 8450369
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g11081
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G08685 AT
Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein | chr4:5550563-5551259 FORWARD LENGTH=159
SoyBase E_val: 1.00E-62 ISS
GO:0006816 GO-bp
Annotation by Michelle Graham. GO Biological Process: calcium ion transport
SoyBase N/A ISS
GO:0007030 GO-bp
Annotation by Michelle Graham. GO Biological Process: Golgi organization
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009651 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salt stress
SoyBase N/A ISS
GO:0019344 GO-bp
Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process
SoyBase N/A ISS
GO:0042546 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF01190 PFAM
Pollen proteins Ole e I like
JGI ISS
UniRef100_B7FN25 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Pollen allergen Phl p n=1 Tax=Medicago truncatula RepID=B7FN25_MEDTR
SoyBase E_val: 2.00E-80 ISS
UniRef100_C6SVR9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SVR9_SOYBN
SoyBase E_val: 1.00E-116 ISS
Expression Patterns of Glyma06g11081
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g11081
Paralog Evidence Comments
Glyma04g11400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g11081 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g105700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g11081
Coding sequences of Glyma06g11081
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g11081.1 sequence type=CDS gene model=Glyma06g11081 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCTCGAGAGCAGTGCTATTGTTGGCTATGTGTGTGCTTCCGGCCATGGTTGTGGCCATTCGCCCAGCAAAGAACCCTTTTTGCGTGAAGGGTCGCGTCTACTGTGACCCTTGCCGTGCTGGTTTTGAGACCTCAGCAACCACCTACATTGCCGGTGCTGAGATTATGTTGCAATGCAAGAGCAGGGTTAGCAACGAGGTTGTGTACACCAAGAAGGGGTACACTGACTCAACTGGAGCATACACAATGTACGTGGACGAGGATCACGCAGATCAAATATGCAGTGCCAAGCTTGTAAGCAGCCCTCACCCTCAATGCAAGGAAGTCACCCCGGGCCGCGACGAAGCCGTCGTTATTCTCACCCGCTACAACGGCATTGCATCCGATGATAGGTTCGCCAATGCCATGGGCTTCATGTCTCAGGAGGTTGCTTCTGGCTGTGCTGAGGTCCTCAGGCAATACGAGGAGTTCGACAATGAGAATTAA
Predicted protein sequences of Glyma06g11081
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g11081.1 sequence type=predicted peptide gene model=Glyma06g11081 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASRAVLLLAMCVLPAMVVAIRPAKNPFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYVDEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVASGCAEVLRQYEEFDNEN*