SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g11081

Feature Type:gene_model
Chromosome:Gm06
Start:8448115
stop:8450369
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G08685AT Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein | chr4:5550563-5551259 FORWARD LENGTH=159 SoyBaseE_val: 1.00E-62ISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0042546GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01190PFAM Pollen proteins Ole e I like JGI ISS
UniRef100_B7FN25UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pollen allergen Phl p n=1 Tax=Medicago truncatula RepID=B7FN25_MEDTR SoyBaseE_val: 2.00E-80ISS
UniRef100_C6SVR9UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SVR9_SOYBN SoyBaseE_val: 1.00E-116ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g11081 not represented in the dataset

Glyma06g11081 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g11400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g105700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g11081.1   sequence type=CDS   gene model=Glyma06g11081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCGAGAGCAGTGCTATTGTTGGCTATGTGTGTGCTTCCGGCCATGGTTGTGGCCATTCGCCCAGCAAAGAACCCTTTTTGCGTGAAGGGTCGCGTCTACTGTGACCCTTGCCGTGCTGGTTTTGAGACCTCAGCAACCACCTACATTGCCGGTGCTGAGATTATGTTGCAATGCAAGAGCAGGGTTAGCAACGAGGTTGTGTACACCAAGAAGGGGTACACTGACTCAACTGGAGCATACACAATGTACGTGGACGAGGATCACGCAGATCAAATATGCAGTGCCAAGCTTGTAAGCAGCCCTCACCCTCAATGCAAGGAAGTCACCCCGGGCCGCGACGAAGCCGTCGTTATTCTCACCCGCTACAACGGCATTGCATCCGATGATAGGTTCGCCAATGCCATGGGCTTCATGTCTCAGGAGGTTGCTTCTGGCTGTGCTGAGGTCCTCAGGCAATACGAGGAGTTCGACAATGAGAATTAA

>Glyma06g11081.1   sequence type=predicted peptide   gene model=Glyma06g11081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASRAVLLLAMCVLPAMVVAIRPAKNPFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYVDEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVASGCAEVLRQYEEFDNEN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo