SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g11010

Feature Type:gene_model
Chromosome:Gm06
Start:8381702
stop:8385197
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g11010
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G78080AT Annotation by Michelle Graham. TAIR10: related to AP2 4 | chr1:29364790-29365794 FORWARD LENGTH=334 SoyBaseE_val: 7.00E-100ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010017GO-bp Annotation by Michelle Graham. GO Biological Process: red or far-red light signaling pathway SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0071472GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to salt stress SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_I1SZ67UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dehydration-responsive element binding protein n=1 Tax=Lespedeza potaninii RepID=I1SZ67_9FABA SoyBaseE_val: 2.00E-152ISS
UniRef100_UPI000067A4E2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000067A4E2 related cluster n=1 Tax=unknown RepID=UPI000067A4E2 SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g11010
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g11010
ParalogEvidenceComments
Glyma04g11290 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g11010 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g105000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g11010
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g11010
>Glyma06g11010.1   sequence type=CDS   gene model=Glyma06g11010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTTTGATGGATTTTTACAGCAGCAGCCCAGAGTTTCAACTTCACTCAGATCCATTCAGGGGAGAACTAATGGAAGTTCTTGAACCTTTTATGAAAAGTCCTTCTCCCAACTATTTCCCTTCCTCCCCCTCCCTCCCTAATCTTTACTCAAACGGGTTATCCAGCAACACCCAAAGCTTAATTGGCTTCGGGCAAGCGCAACCCACATCTCTTGTGGGCCTGAACCACCTAACCCCATCTCAGATCTCTCAGATCCAAGCCCAAATCCAGATCCAGGCCCAGCAGCATCAGAATCGCAGCAACACCCTGAGCTTCCTTGGGCCGAAGCCCATCCCCATGAAGCACGCGGGCATGCCTCCGAAGCCCACGAAGCTTTACAGAGGGGTGAGACAGAGGCACTGGGGAAAGTGGGTGGCTGAGATCAGACTTCCCAAGAACCGGACCAGGCTGTGGCTGGGAACCTTCGACACCGCCGAGGAAGCCGCTCTGGCATACGACAAGGCCGCGTACAAGCTCCGAGGTGACTTCGCCAGGCTCAACTTCCCAAACCTGCGACACCAGGGTTCCTCCGTCGGTGGTGATTTCGGGGAGTACAAGCCTCTTCATTCCGCTGTTGACGCCAAGCTTCAGGCCATTTGCGAAGGCCTGGCTGAGCTGCAGAAACAGGGGAAGACCGAGAAGCCTCCGAGGAAGTCGCGTTCCAAACTCGCGGAGAAGGTTGTTTCCGACAAGGAGAACAACAACTCTTGTAAGGTGGAAGCTGCGTCCTGGTCGTCGGAAGGTTCTTCGCCGCTTTCGGATCTGACGTTTGCTGACGTGAGCGAGGCTCAGTGGGAAGGTGATTCGGATAATTATAATCTCCAGAAGTACCCCTCTTATGAGATCGATTGGGATTCTCTGTGA
Predicted protein sequences of Glyma06g11010
>Glyma06g11010.1   sequence type=predicted peptide   gene model=Glyma06g11010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAALMDFYSSSPEFQLHSDPFRGELMEVLEPFMKSPSPNYFPSSPSLPNLYSNGLSSNTQSLIGFGQAQPTSLVGLNHLTPSQISQIQAQIQIQAQQHQNRSNTLSFLGPKPIPMKHAGMPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSSVGGDFGEYKPLHSAVDAKLQAICEGLAELQKQGKTEKPPRKSRSKLAEKVVSDKENNNSCKVEAASWSSEGSSPLSDLTFADVSEAQWEGDSDNYNLQKYPSYEIDWDSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo