SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g10860

Feature Type:gene_model
Chromosome:Gm06
Start:8233646
stop:8235039
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g10860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G34640AT Annotation by Michelle Graham. TAIR10: peptidases | chr1:12687706-12688427 REVERSE LENGTH=110 SoyBaseE_val: 3.00E-31ISS
GO:0006465GO-bp Annotation by Michelle Graham. GO Biological Process: signal peptide processing SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005787GO-cc Annotation by Michelle Graham. GO Cellular Compartment: signal peptidase complex SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
PF06645PFAM Microsomal signal peptidase 12 kDa subunit (SPC12) JGI ISS
UniRef100_I1K9Z0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K9Z0_SOYBN SoyBaseE_val: 4.00E-75ISS

Expression Patterns of Glyma06g10860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g10860
ParalogEvidenceComments
Glyma04g11070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g10860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g103500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g10860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g10860
>Glyma06g10860.1   sequence type=CDS   gene model=Glyma06g10860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAACGACGCCGCTCTGAGAAGCTCTCTGCTGTGGCTGGCAGCAGTTATATTGGTGGTTGGAATATGCACCCACTCTTTGAAGAAGATGATGACCACCTATGTCTTGGGTGTTCTTGGGATTGCTGCTGTGCTTCTTCCTGATTGGGATTACTTCAACCGTGATTTCTCTCGTTGGCCTTATCCTGTCACTTCTGAGGAAAGGGCCAATTCTTCTCTTCATGCCCAAGGATCTGGTTTTCTAAGGTTTGCGAATTCTCCTCTTAGGGTGATTGGTTATAGCGTGGTTTATGGATATGCCATGTACAAATGGTGGGAGTATGTGTCAACCTAA
Predicted protein sequences of Glyma06g10860
>Glyma06g10860.1   sequence type=predicted peptide   gene model=Glyma06g10860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANDAALRSSLLWLAAVILVVGICTHSLKKMMTTYVLGVLGIAAVLLPDWDYFNRDFSRWPYPVTSEERANSSLHAQGSGFLRFANSPLRVIGYSVVYGYAMYKWWEYVST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo