Report for Sequence Feature Glyma06g10710
Feature Type: gene_model
Chromosome: Gm06
Start: 8099724
stop: 8101651
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g10710
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G08950 AT
Annotation by Michelle Graham. TAIR10: Phosphate-responsive 1 family protein | chr4:5740378-5741322 FORWARD LENGTH=314
SoyBase E_val: 9.00E-154 ISS
GO:0009741 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus
SoyBase N/A ISS
GO:0016126 GO-bp
Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0009505 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF04674 PFAM
Phosphate-induced protein 1 conserved region
JGI ISS
UniRef100_G7LH86 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Phi-1 protein n=1 Tax=Medicago truncatula RepID=G7LH86_MEDTR
SoyBase E_val: 2.00E-171 ISS
UniRef100_I1K9W9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K9W9_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g10710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g10710
Paralog Evidence Comments
Glyma04g10880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g10710 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g102100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g10710
Coding sequences of Glyma06g10710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g10710.1 sequence type=CDS gene model=Glyma06g10710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCACTCTTGTTCTTTACCAATTCTTTCTCAAACTCTTGCTCCTAATTTCAGTCTTTCAGCTTTCCTTTGCTGCTAGGAGACTCAACCAGCTGGTTCAGGACCAGTCACAGTTACTCCATTACCACAACGGTCCTCTTCTATACGGCAAAATCGCCGTGAACCTAATCTGGTATGGTCACTTCAAACCATCCCAAAAGGCCATCATCACCGATTTCGTTACCTCACTGTCATCCCCATCGTCTCAGAGCAGCCAGCCATCTGTTGCCACGTGGTGGAAAACCACGGAGAAGTACTACCACCTGAGTCCCAAGAACAAGAAGGCTGCTTCTTCTCTTTCTCTATCACTGGGCGATCAGTTTCTCGACGAGGGTTTCTCGCTGGGGAAGTCACTAACCAGCAAGAACCTCGTCGAGCTGGCATCCAAAGGGGGACAGAGGAACGCCATCAACGTTGTTCTGACATCCGCTGACGTGGCAGTCGAAGGTTTCTGTATGAGCCGATGTGGGACCCACGGCTCCTCCTCTTCTGCATCTCACGTGAAGAAGAACAACAACGGCAAGAACTACAAGTTCGCTTACATCTGGGTCGGAAACTCCGAAACCCAATGCCCGGGGCAATGCGCTTGGCCATTCCACCAACCCATTTATGGGCCCCAGAGCCCACCCTTGGTTGCTCCCAACAACGATGTGGGACTTGACGGAATGGTCATAAACCTCGCTAGCCTCCTTGCCGGAACCGCCACCAACCCATTCGGAAACGGTTACTTCCAGGGTCCCGCGGAGGCTCCGCTCGAAGCTGCGTCGGCTTGCCCTGGGGTTTATGGGAAAGGGGCTTACCCTGGTTATGCTGGGAACTTGCTGGTTGACTCTGCCACTGGTGCTAGCTACAATGTGGAGGGGGATAATGGGAGGAAGTACCTTGTTCCTGCTCTGTATGATCCTTCTACATCGTCTTGCTCAACGCCCGTCTGA
Predicted protein sequences of Glyma06g10710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g10710.1 sequence type=predicted peptide gene model=Glyma06g10710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATLVLYQFFLKLLLLISVFQLSFAARRLNQLVQDQSQLLHYHNGPLLYGKIAVNLIWYGHFKPSQKAIITDFVTSLSSPSSQSSQPSVATWWKTTEKYYHLSPKNKKAASSLSLSLGDQFLDEGFSLGKSLTSKNLVELASKGGQRNAINVVLTSADVAVEGFCMSRCGTHGSSSSASHVKKNNNGKNYKFAYIWVGNSETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVINLASLLAGTATNPFGNGYFQGPAEAPLEAASACPGVYGKGAYPGYAGNLLVDSATGASYNVEGDNGRKYLVPALYDPSTSSCSTPV*