SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g10621

Feature Type:gene_model
Chromosome:Gm06
Start:8024477
stop:8025437
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g10621
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11870AT Annotation by Michelle Graham. TAIR10: Seryl-tRNA synthetase | chr1:4003895-4006556 FORWARD LENGTH=514 SoyBaseE_val: 2.00E-83ISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006399GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA metabolic process SoyBaseN/AISS
GO:0006418GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation SoyBaseN/AISS
GO:0006434GO-bp Annotation by Michelle Graham. GO Biological Process: seryl-tRNA aminoacylation SoyBaseN/AISS
GO:0007005GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrion organization SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009069GO-bp Annotation by Michelle Graham. GO Biological Process: serine family amino acid metabolic process SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0043039GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004812GO-mf Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity SoyBaseN/AISS
GO:0004828GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-tRNA ligase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11778Panther SERYL-TRNA SYNTHETASE JGI ISS
PF00587PFAM tRNA synthetase class II core domain (G, H, P, S and T) JGI ISS
UniRef100_G7J3Z0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Seryl-tRNA synthetase n=2 Tax=Medicago truncatula RepID=G7J3Z0_MEDTR SoyBaseE_val: 3.00E-92ISS
UniRef100_I1JVB5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Glycine max RepID=I1JVB5_SOYBN SoyBaseE_val: 2.00E-103ISS

Expression Patterns of Glyma06g10621
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g10621 not represented in the dataset
Glyma06g10621 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g10621
ParalogEvidenceComments
Glyma04g10750 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g10621 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g101300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g10621
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g10621
>Glyma06g10621.1   sequence type=CDS   gene model=Glyma06g10621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTCTTTATCGAGTTCACCAATTCAGCAAGGTGGAAATGTTTATTTTCTGCCGCCCAGAAGAGAGTGAACACTATCACCAAGAGCTTATTAAAATTGAAGAAGACCTCTTCTCATCCCTGGGATTGCATTTTAAATTAGGTGCAGCTGCTTATCATAAATTCGATGTGGAGGCATGGATGCCTGGTTTAGAACGGTTTGGTGAGATCTCAAGCGCCTCAAATTGCACAGACTATCAGAGCCGTCGTTTGGGAATAAGGTATTGTCCTGCATCAGAAGCACAAGCCACAAGTGCAAAAAAATCTAAAGGCAATCTTGCTCCACCACAGTTTGTTCACACATTAAATGCAACAGCCTGTGCAGTACCACGAATGATTATATGTTTGCTTGAGAATCATCAACAAGAAGATGGATCTGTCCTTATCCCTGAGCCCTTGAGGCCTTTCATGGGTGGCCTTAGTGTCATCGCTATAAAATCTTTATGA
Predicted protein sequences of Glyma06g10621
>Glyma06g10621.1   sequence type=predicted peptide   gene model=Glyma06g10621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GLYRVHQFSKVEMFIFCRPEESEHYHQELIKIEEDLFSSLGLHFKLGAAAYHKFDVEAWMPGLERFGEISSASNCTDYQSRRLGIRYCPASEAQATSAKKSKGNLAPPQFVHTLNATACAVPRMIICLLENHQQEDGSVLIPEPLRPFMGGLSVIAIKSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo