SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g10500

Feature Type:gene_model
Chromosome:Gm06
Start:7963409
stop:7964419
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g10500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G72230AT Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein | chr1:27188287-27189093 FORWARD LENGTH=181 SoyBaseE_val: 2.00E-40ISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF02298PFAM Plastocyanin-like domain JGI ISS
UniRef100_C6SZQ8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZQ8_SOYBN SoyBaseE_val: 6.00E-114ISS
UniRef100_Q41001UniRef Annotation by Michelle Graham. Most informative UniRef hit: Blue copper protein n=1 Tax=Pisum sativum RepID=BCP_PEA SoyBaseE_val: 2.00E-64ISS

Expression Patterns of Glyma06g10500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g10500
ParalogEvidenceComments
Glyma04g10670 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g10500 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g100300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g10500
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g10500
>Glyma06g10500.1   sequence type=CDS   gene model=Glyma06g10500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATTCTCTAGTGCTTTGATTCTGTGGTCGTTGCTAGCAATCAACATGGCCCTGCCAACCCTCGCAACCGTCTACACCGTGGGAGATACTTCAGGTTGGGCAATTGGTACTGATTATAGCACTTGGACTGGCGACAAGATCTTTTCAGTGGGTGATAGTCTCGCGTTCAACTATGGAGCTGGGCACACAGTGGATGAAGTTAAAGAGAGCGATTACAAGTCGTGCACCGCAGGGAATTCTATTAGCACAGACAGTAGTGGTGCGACCACAATTGCCCTTAAAAGTGCAGGCACTCATTACTTCATATGTTCTGTTCCTGGACATTGTTCTGGCGGTATGAAACTTGCCGTCACTGTCAAATCAGGAAAAGCCTCTGATGCCACACCCACTACTTCCACTACTACCGCCACTAAATCAAACTCGTCTTCAGCGAGTAGTGTCTCACCAATTGTTGCTATGTTCATTGTTTCCTCGATCTCTTACTATGTTTTGCGTATGCTATAA
Predicted protein sequences of Glyma06g10500
>Glyma06g10500.1   sequence type=predicted peptide   gene model=Glyma06g10500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFSSALILWSLLAINMALPTLATVYTVGDTSGWAIGTDYSTWTGDKIFSVGDSLAFNYGAGHTVDEVKESDYKSCTAGNSISTDSSGATTIALKSAGTHYFICSVPGHCSGGMKLAVTVKSGKASDATPTTSTTTATKSNSSSASSVSPIVAMFIVSSISYYVLRML*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo