Glyma06g10390 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g10390

Feature Type:	gene_model
Chromosome:	Gm06
Start:	7874745
stop:	7875738
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g10390

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G09270	AT	Annotation by Michelle Graham. TAIR10: glutathione S-transferase TAU 8 \| chr3:2848407-2849226 REVERSE LENGTH=224	SoyBase	E_val: 1.00E-26	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0043161	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004364	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity	SoyBase	N/A	ISS
KOG0406	KOG	Glutathione S-transferase	JGI		ISS
PTHR11260	Panther	GLUTATHIONE S-TRANSFERASE, GST, SUPERFAMILY, GST DOMAIN CONTAINING	JGI		ISS
PTHR11260:SF16	Panther	GLUTATHIONE S-TRANSFERASE THETA	JGI		ISS
PF02798	PFAM	Glutathione S-transferase, N-terminal domain	JGI		ISS
UniRef100_B9T2Q6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutathione s-transferase, putative n=1 Tax=Ricinus communis RepID=B9T2Q6_RICCO	SoyBase	E_val: 5.00E-30	ISS
UniRef100_I1K9T8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K9T8_SOYBN	SoyBase	E_val: 2.00E-94	ISS

Proteins Associated with Glyma06g10390

Locus	Gene Symbol	Protein Name
	GSTU8	glutathione transferase

Expression Patterns of Glyma06g10390

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g10390 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g099000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g10390

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g10390

Limit To All Plant Sequences

>Glyma06g10390.1   sequence type=CDS   gene model=Glyma06g10390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCCTACAGTATAACCCTGTCCACAAGAAGCTACCGGCTCTCGTGCATGACGGTAAGCCCCTGGCAGAATCACTAGTGATTCTTGAGTATATTGATGAGACCTGGAAGCAAGATCCCTCCCTTCTTCCACATGATCCCTATGAAAAGGCCAATGCGATTCTGCATGTTATTAAGTGCTTTATTGAACACAAAGAATCTGATATTGCTATTGGTTGGCTTGGATACTGGGTACGAATAGTGGAGGAAATTGTGGGCGTAAACCTCATTAATGAAGAGTTGATGGCTAAGCTTGATGCTTGGTTCGATAATTTTCTTGAGCTTCCTGTTATCAACGAATGCATGTCGCCTCGTGACAAACTGCTTAACCACAACAAGGCCTTCCACAAGCTCTTGACATCTTCATCCACTTGA

Predicted protein sequences of Glyma06g10390

Limit To All Plant Sequences

>Glyma06g10390.1   sequence type=predicted peptide   gene model=Glyma06g10390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLQYNPVHKKLPALVHDGKPLAESLVILEYIDETWKQDPSLLPHDPYEKANAILHVIKCFIEHKESDIAIGWLGYWVRIVEEIVGVNLINEELMAKLDAWFDNFLELPVINECMSPRDKLLNHNKAFHKLLTSSST*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain