Glyma06g09980 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g09980

Feature Type:	gene_model
Chromosome:	Gm06
Start:	7520862
stop:	7523918
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g09980

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G28200	AT	Annotation by Michelle Graham. TAIR10: FH interacting protein 1 \| chr1:9850395-9852300 REVERSE LENGTH=259	SoyBase	E_val: 4.00E-117	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0016197	GO-bp	Annotation by Michelle Graham. GO Biological Process: endosomal transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02893	PFAM	GRAM domain	JGI		ISS
UniRef100_G7J579	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GLABRA2 expression modulator n=1 Tax=Medicago truncatula RepID=G7J579_MEDTR	SoyBase	E_val: 3.00E-135	ISS
UniRef100_I1K9P5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K9P5_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g09980

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g09980

Paralog	Evidence	Comments
Glyma04g09920	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g09980 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g095300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g09980

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g09980

Limit To All Plant Sequences

>Glyma06g09980.1   sequence type=CDS   gene model=Glyma06g09980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGCTGACGCCCCACCCCAAACCCAAGCCACCAACACCAAACCGGAAGAATCTCAATCTCAATCTCAGTCTCAGCCTCAGCGTCACTCCGGCGATTATGCTCCATACCCTAAACTGGACCCCACCGATGTTGCGCCACCACAACAACCACTGAACACTGAATCTCGCGCTCCCATTTCCGAAGATGCTGCCACTACTATGCCCAAAGACTCCAATCCCTATGTCACTCCTGCTCCCGTCACTGCTTCTTCTACTAAGACTACTTTAGATTCGGTGAAAGACGTTCTCGGGAAATGGGGGAAGAAAGCCGCCGAGGCCACCAAGAAGGCCGAGGATCTCGCCGGCAACATGTGGCAGCACTTGAAAACGGGACCGAGTTTTGCTGATGCTGCCGTGGGGAGGATTGCTCAGGGAACTAAGGTTCTTGCAGAAGGAGGGTATGAAAAGATCTTTAGGCAAACATTTGAGACAGTTCCGGAGGAGCAGCTTCTCAAAACTTATGCATGCTACTTGTCTACCTCGGCTGGACCTGTGATGGGAGTCTTATATTTGTCAACGGCTAAGCTGGCATTTTGTAGTGATAACCCACTTTCTTACCAAGTGGGTGACCAGACTCAATGGAGCTATTATAAGGTGGTCATTCCATTGCACCAGCTGAGAGCTGTAAACGCATCCACAAGCAAAACCAACCAATCTGAAAAATATATACAGATTATCTCTGTTGACAACCATGAATTTTGGTTTATGGGCTTTGTGCACTATGACAGCGCTGTTAAAAATATTCAAGGAGCATTGCAGCCTCATTGA

Predicted protein sequences of Glyma06g09980

Limit To All Plant Sequences

>Glyma06g09980.1   sequence type=predicted peptide   gene model=Glyma06g09980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSADAPPQTQATNTKPEESQSQSQSQPQRHSGDYAPYPKLDPTDVAPPQQPLNTESRAPISEDAATTMPKDSNPYVTPAPVTASSTKTTLDSVKDVLGKWGKKAAEATKKAEDLAGNMWQHLKTGPSFADAAVGRIAQGTKVLAEGGYEKIFRQTFETVPEEQLLKTYACYLSTSAGPVMGVLYLSTAKLAFCSDNPLSYQVGDQTQWSYYKVVIPLHQLRAVNASTSKTNQSEKYIQIISVDNHEFWFMGFVHYDSAVKNIQGALQPH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain