Report for Sequence Feature Glyma06g09680
Feature Type: gene_model
Chromosome: Gm06
Start: 7263051
stop: 7269256
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g09680
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G64460 AT
Annotation by Michelle Graham. TAIR10: Phosphoglycerate mutase family protein | chr5:25773009-25775104 REVERSE LENGTH=282
SoyBase E_val: 6.00E-141 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009736 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG4754
KOG
Predicted phosphoglycerate mutase
JGI ISS
PTHR23029 Panther
PHOSPHOGLYCERATE MUTASE
JGI ISS
PF00300 PFAM
Phosphoglycerate mutase family
JGI ISS
UniRef100_I1K9L2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K9L2_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q8LGT8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Phosphoglycerate mutase-like protein n=1 Tax=Glycine max RepID=Q8LGT8_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g09680
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g09680
Paralog Evidence Comments
Glyma04g09590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g09680 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g092100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g09680
Coding sequences of Glyma06g09680
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g09680.1 sequence type=CDS gene model=Glyma06g09680 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATACTGCTGCAGGTCAAAGTCCTCACCCATTGCACCGTTGCAAGACTCTTCACCTGGTAAGACATGCCCAAGGATTTCACAATGTAGAAGGTGAGAAGAACTTTGAAGCATACAAGTCTTATGATCTTTTTGATGCAAACCTGACCCCTCTCGGCTGGAATCAGGTTGATAATCTGAGAGAGCATGTTAAGGCCAGTGGTCTTTCCAAAAAAATTGAACTAGTTATTGTTTCCCCCTTGTTAAGGACTATGCAAACAGCAGTTGGAGTATTTGGTGGGGAAGCATATACTGATGGGATTAATGTACCTCCCCTAATGAATGACAATGTGGGAGATAGTCGTCGCCCTGCAATTTCCAGTCTAAATGTCCCACCATTTATAGCAGTAGAGCTTTGCCGAGAACATTTGGGGGTGTATCCTTGTGATAAGAGAAGAAACATCACTGACTACCGACATATGTTTCCAGCTATTGATTTTTCATTGATAGAAAACGATGACGACATTTTGTGGAAACCTGACATTAGAGAGAAGAATGAAGAAGTTGCTGCCAGGGGACTGAAATTTTTGGAATGGTTGTGGACACGGAAAGAAAAGGAGATAGCTGTCGTTACCCACAGTGGTTTTCTGTTTCATTCCTTAAGTGCTTTTGGAAATGATTGTCATCCAAACGTGAAGAATGAAATCTGCACACACTTTGCTAACTGTGAGCTACGTTCAATGGTTATCATTGACAGAGGTGTGATTGGTTCAGATGAGTCCTCTACCAACTATACTGGCAAAATTCCATATGGCCGGCCTTGA
Predicted protein sequences of Glyma06g09680
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g09680.1 sequence type=predicted peptide gene model=Glyma06g09680 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDTAAGQSPHPLHRCKTLHLVRHAQGFHNVEGEKNFEAYKSYDLFDANLTPLGWNQVDNLREHVKASGLSKKIELVIVSPLLRTMQTAVGVFGGEAYTDGINVPPLMNDNVGDSRRPAISSLNVPPFIAVELCREHLGVYPCDKRRNITDYRHMFPAIDFSLIENDDDILWKPDIREKNEEVAARGLKFLEWLWTRKEKEIAVVTHSGFLFHSLSAFGNDCHPNVKNEICTHFANCELRSMVIIDRGVIGSDESSTNYTGKIPYGRP*