Glyma06g09600 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g09600

Feature Type:	gene_model
Chromosome:	Gm06
Start:	7167353
stop:	7169193
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g09600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G27530	AT	Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Ubiquitin-conjugating enzyme/RWD-like (InterPro:IPR016135), Ubiquitin-fold modifier-conjugating enzyme 1 (InterPro:IPR014806); Has 269 Blast hits to 269 proteins in 110 species: Archae - 0; Bacteria - 0; Metazoa - 175; Fungi - 0; Plants - 42; Viruses - 0; Other Eukaryotes - 52 (source: NCBI BLink). \| chr1:9562761-9563887 REVERSE LENGTH=174	SoyBase	E_val: 2.00E-122	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3357	KOG	Uncharacterized conserved protein	JGI		ISS
PTHR12921	Panther	FAMILY NOT NAMED	JGI		ISS
PF08694	PFAM	Ubiquitin-fold modifier-conjugating enzyme 1	JGI		ISS
UniRef100_C6T5A5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5A5_SOYBN	SoyBase	E_val: 8.00E-128	ISS
UniRef100_G7J432	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-fold modifier-conjugating enzyme n=2 Tax=Medicago truncatula RepID=G7J432_MEDTR	SoyBase	E_val: 7.00E-122	ISS

Expression Patterns of Glyma06g09600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g09600

Paralog	Evidence	Comments
Glyma04g09500	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g09600 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g091400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g09600

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g09600

Limit To All Plant Sequences

>Glyma06g09600.1   sequence type=CDS   gene model=Glyma06g09600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGGTTGGGACCCGAATACGAAGTCGACGCTGACACAGATCCCTCTGCTGACGACGAAGGCGGGTCCACGAGACGGAGCGGCATGGACGCAGAGGCTTAAGGAAGAGTACAAGGCTCTGATAGCGTACACGCAGATGAACAAGTCCAACGACAACGATTGGTTCCGTATCTCCGCCGCCAATCCGGAAGGCACTCGCTGGACCGGTAAATGCTGGTACGTTCACAACCTCCTCAAGTACGAATTCGACCTCCAATTCGATGTCCCCGTCACTTACCCTTCCACCGCCCCCGAACTCGAACTCCCTCAATTGGATGGCAAAACCCAAAAGATGTATAGGGGTGGAAAGATCTGCTTGACTGTGCACTTCAAGCCTCTCTGGGCCAAAAATTGCCCCAGATTTGGTATTGCACATGCACTTTGCTTAGGTCTTGCACCGTGGCTTGCAGCAGAGGTTCCCATCCTCGTTGATTCTGGTATGATCAAGCACAAAGATGACACCGCAACCACATCAACTGAATCTTAG

Predicted protein sequences of Glyma06g09600

Limit To All Plant Sequences

>Glyma06g09600.1   sequence type=predicted peptide   gene model=Glyma06g09600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGWDPNTKSTLTQIPLLTTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDVPVTYPSTAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEVPILVDSGMIKHKDDTATTSTES*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain