|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G60070 | AT | Annotation by Michelle Graham. TAIR10: Adaptor protein complex AP-1, gamma subunit | chr1:22142944-22149296 REVERSE LENGTH=862 | SoyBase | E_val: 1.00E-11 | ISS |
GO:0006886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular protein transport | SoyBase | N/A | ISS |
GO:0015031 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein transport | SoyBase | N/A | ISS |
GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0030117 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane coat | SoyBase | N/A | ISS |
GO:0030131 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: clathrin adaptor complex | SoyBase | N/A | ISS |
GO:0008565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein transporter activity | SoyBase | N/A | ISS |
GO:0030276 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: clathrin binding | SoyBase | N/A | ISS |
UniRef100_B9S4M0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: AP-1 complex subunit gamma-2, putative n=1 Tax=Ricinus communis RepID=B9S4M0_RICCO | SoyBase | E_val: 5.00E-11 | ISS |
UniRef100_UPI0002337569 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002337569 related cluster n=1 Tax=unknown RepID=UPI0002337569 | SoyBase | E_val: 2.00E-11 | ISS |
Glyma06g09441 not represented in the dataset |
Glyma06g09441 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.06g089900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g09441.1 sequence type=CDS gene model=Glyma06g09441 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGCATTGAAGATAATGGTGGCTTACGTGTACTTGCCATTAATATCCTGGGAAGATTCTTGTCAAACTGTGACAACAATATCAGGTTTATTTCCTTCTCTTTCATAACTTTGATGGTCGCAACTTGGATTGGGCAAAATCAGAAGATAAGGCTTATGGTGGTCGAAATCAACCTCCGTGGCGACGGAGCAGAGAGACTGAGGGAGCGAGGTCGAGCAAAGGCCCCAGAGTAA
>Glyma06g09441.1 sequence type=predicted peptide gene model=Glyma06g09441 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSIEDNGGLRVLAINILGRFLSNCDNNIRFISFSFITLMVATWIGQNQKIRLMVVEINLRGDGAERLRERGRAKAPE*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||