|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G25880 | AT | Annotation by Michelle Graham. TAIR10: ataurora2 | chr2:11034887-11036827 REVERSE LENGTH=256 | SoyBase | E_val: 3.00E-33 | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
| GO:0010075 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth | SoyBase | N/A | ISS |
| GO:0010103 | GO-bp | Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis | SoyBase | N/A | ISS |
| GO:0016572 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone phosphorylation | SoyBase | N/A | ISS |
| GO:0042127 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation | SoyBase | N/A | ISS |
| GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
| GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
| GO:0004713 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
| GO:0035175 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone kinase activity (H3-S10 specific) | SoyBase | N/A | ISS |
| PTHR24350 | Panther | SERINE/THREONINE-PROTEIN KINASE IAL-RELATED | JGI | ISS | |
| PF00069 | PFAM | Protein kinase domain | JGI | ISS | |
| UniRef100_B9RRX5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine-protein kinase, putative n=1 Tax=Ricinus communis RepID=B9RRX5_RICCO | SoyBase | E_val: 4.00E-31 | ISS |
| UniRef100_UPI000233A49C | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A49C related cluster n=1 Tax=unknown RepID=UPI000233A49C | SoyBase | E_val: 2.00E-38 | ISS |
|
Glyma06g09345 not represented in the dataset |
Glyma06g09345 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g088700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g09345.1 sequence type=CDS gene model=Glyma06g09345 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCATCGCAACAGAGACTCAACCTCAACTCCAACACCACACGACTAGTCACATTGTTGCTTTGAAAGTACTCTTTAAGTGCCAATTGCAACAATCCCAAGTCGTGCATCAACTTCAACGTGAAGTTGAAATACAAAGTCATCTCCGACATCCCCACATCTTGCGCCTTTATGGATACTTTTATGATCAGAAACGAATTTATTTGATTTTAGAGTATGCACCCAAAGGTGAACTTTACAACGGAGTTGCAGAAATGCAAATATTTCAGTGA
>Glyma06g09345.1 sequence type=predicted peptide gene model=Glyma06g09345 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAIATETQPQLQHHTTSHIVALKVLFKCQLQQSQVVHQLQREVEIQSHLRHPHILRLYGYFYDQKRIYLILEYAPKGELYNGVAEMQIFQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||