Glyma06g09261 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g09261): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g09261): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g09261

Feature Type:	gene_model
Chromosome:	Gm06
Start:	6810435
stop:	6811139
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g09261

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G09770	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L17 family protein \| chr5:3035267-3036518 REVERSE LENGTH=160	SoyBase	E_val: 2.00E-36	ISS
GO:0000394	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009086	GO-bp	Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PTHR14413	Panther	RIBOSOMAL PROTEIN L17	JGI		ISS
PTHR14413:SF7	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF01196	PFAM	Ribosomal protein L17	JGI		ISS
UniRef100_B9RU17	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L17, putative n=1 Tax=Ricinus communis RepID=B9RU17_RICCO	SoyBase	E_val: 3.00E-35	ISS
UniRef100_C6SWX5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWX5_SOYBN	SoyBase	E_val: 1.00E-37	ISS

Expression Patterns of Glyma06g09261

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g09261 not represented in the dataset	Glyma06g09261 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g09261 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g09261

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g09261

Limit To All Plant Sequences

>Glyma06g09261.1   sequence type=CDS   gene model=Glyma06g09261   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATGATGTCCTTAACAAGCTGTTTACAGAACTGGCTTATCGGTACAAGGATAGAGCTGGAGGATACACAAGATTGCTTCGGACCCGTATTCGAGTTCTTGAAATTGAAAATTTAGAAAATGAGCTTAGGCAGTCAAAGCCACCAACTCCTCAGGCACCACAGAGAGCACCCCTTGATCCCTGGACGCGTTCTCCTCTTAGTAGGCAATTTGCACCTCCTAAAGAGGACAAATCTGCTTTGATTTGTGATGAATTTGAATGTAATGCCGATACTGTTTTTCCCCGCATAGCGTGA

Predicted protein sequences of Glyma06g09261

Limit To All Plant Sequences

>Glyma06g09261.1   sequence type=predicted peptide   gene model=Glyma06g09261   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DDVLNKLFTELAYRYKDRAGGYTRLLRTRIRVLEIENLENELRQSKPPTPQAPQRAPLDPWTRSPLSRQFAPPKEDKSALICDEFECNADTVFPRIA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain