Glyma06g09251 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g09251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g09251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g09251

Feature Type:	gene_model
Chromosome:	Gm06
Start:	6805630
stop:	6809359
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g09251

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16360	AT	Annotation by Michelle Graham. TAIR10: HPT phosphotransmitter 4 \| chr3:5554351-5555518 FORWARD LENGTH=145	SoyBase	E_val: 2.00E-54	ISS
GO:0000160	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system	SoyBase	N/A	ISS
GO:0009736	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0080036	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004871	GO-mf	Annotation by Michelle Graham. GO Molecular Function: signal transducer activity	SoyBase	N/A	ISS
GO:0009927	GO-mf	Annotation by Michelle Graham. GO Molecular Function: histidine phosphotransfer kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
KOG4747	KOG	Two-component phosphorelay intermediate involved in MAP kinase cascade regulation	JGI		ISS
PF01627	PFAM	Hpt domain	JGI		ISS
UniRef100_I4IY29	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histidine phosphotransfer protein n=1 Tax=Populus x canadensis RepID=I4IY29_POPCA	SoyBase	E_val: 1.00E-65	ISS
UniRef100_UPI000233A499	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A499 related cluster n=1 Tax=unknown RepID=UPI000233A499	SoyBase	E_val: 3.00E-94	ISS

Expression Patterns of Glyma06g09251

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g09251 not represented in the dataset	Glyma06g09251 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g09251 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g088100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g09251

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g09251

Limit To All Plant Sequences

>Glyma06g09251.1   sequence type=CDS   gene model=Glyma06g09251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAAGACTAAGTTGAGACAACGGGCCGTCTTCACACGAAATTCACTCTTTGATGAGGGGTTCCTTGATGAGCAATTCATTCAGTTAGAGGAATTGCAAGACGATGTTAATCCCAATTTTGCGGAAGAAATTGTGACCCTTTTCTACAGCGACTCTGTAAGACTGATCTACAACATAGAACGAGCACTGATGAGTAACCCTCCGAATTTCACCAAGCTAGATGGTTACATGCTTCAATTCAAGGGTAGTTGCTCAAGCATCGGAGCAAAGAAGGTGAAAAATGAATGTACCAGATTCAGTGAATATTGCGCAGCAGAAAACTTTGAGGGATGCTTCAGGACTTTCCAACAAATCAATGTAGAGTATACGACTTTGAAGAAGAAGCTCGAGACTTACTTTCAGTTGGTAAGGGGAAGCTGCTCAAATTAA

Predicted protein sequences of Glyma06g09251

Limit To All Plant Sequences

>Glyma06g09251.1   sequence type=predicted peptide   gene model=Glyma06g09251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKTKLRQRAVFTRNSLFDEGFLDEQFIQLEELQDDVNPNFAEEIVTLFYSDSVRLIYNIERALMSNPPNFTKLDGYMLQFKGSCSSIGAKKVKNECTRFSEYCAAENFEGCFRTFQQINVEYTTLKKKLETYFQLVRGSCSN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain