Glyma06g08937 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g08937): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g08937): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g08937

Feature Type:	gene_model
Chromosome:	Gm06
Start:	6513083
stop:	6518631
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g08937

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G06400	AT	Annotation by Michelle Graham. TAIR10: chromatin-remodeling protein 11 \| chr3:1941066-1946700 FORWARD LENGTH=1057	SoyBase	E_val: 3.00E-15	ISS
GO:0008284	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation	SoyBase	N/A	ISS
GO:0009553	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac development	SoyBase	N/A	ISS
GO:0009630	GO-bp	Annotation by Michelle Graham. GO Biological Process: gravitropism	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008094	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-dependent ATPase activity	SoyBase	N/A	ISS
UniRef100_G7ISH3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chromatin remodeling complex subunit n=1 Tax=Medicago truncatula RepID=G7ISH3_MEDTR	SoyBase	E_val: 2.00E-18	ISS
UniRef100_UPI000233B16B	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B16B related cluster n=1 Tax=unknown RepID=UPI000233B16B	SoyBase	E_val: 7.00E-34	ISS

Expression Patterns of Glyma06g08937

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g08937 not represented in the dataset	Glyma06g08937 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g08937 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g084900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g08937

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g08937

Limit To All Plant Sequences

>Glyma06g08937.1   sequence type=CDS   gene model=Glyma06g08937   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAGACCTCTCAAGCCACACTCATCTTCCCACGAAGCGCTCTCCAATGCTTCCAGTTCGTCCGAGGAAGAGGAGCAAGTCAACGAGCAGATCAGCGAAGAGGAAGACGAGGAGGAACTCGAGGCGGTGGTGCGCCCCGCCAGTTCCGACTATGACGAAGACGATGACAAAGTTGCCGGCGACAATCCACCGAACTCCGATGAATATTCCGCTGCCGCCGATGACCTGGATGGGGATAGTGTTGATCCCGAAATTAGCAAGCAAGAGAAGACTAGATTAAAAGAAATAATGCAGAAAGTGAAGAAACAGAAGATTCAGGAGATACTGGATGCACAGAATGCGGCCATTGACACTGACATGTTACGAACAATCGAGGGAAGGGGGCGTCTGAAGTATCTCTTGCAGTAG

Predicted protein sequences of Glyma06g08937

Limit To All Plant Sequences

>Glyma06g08937.1   sequence type=predicted peptide   gene model=Glyma06g08937   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARPLKPHSSSHEALSNASSSSEEEEQVNEQISEEEDEEELEAVVRPASSDYDEDDDKVAGDNPPNSDEYSAAADDLDGDSVDPEISKQEKTRLKEIMQKVKKQKIQEILDAQNAAIDTDMLRTIEGRGRLKYLLQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain