| 
 | 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT3G06400 | AT | Annotation by Michelle Graham. TAIR10: chromatin-remodeling protein 11 | chr3:1941066-1946700 FORWARD LENGTH=1057 | SoyBase | E_val: 3.00E-15 | ISS | 
| GO:0008284 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation | SoyBase | N/A | ISS | 
| GO:0009553 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo sac development | SoyBase | N/A | ISS | 
| GO:0009630 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gravitropism | SoyBase | N/A | ISS | 
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS | 
| GO:0016049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell growth | SoyBase | N/A | ISS | 
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS | 
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS | 
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS | 
| GO:0008094 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA-dependent ATPase activity | SoyBase | N/A | ISS | 
| UniRef100_G7ISH3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Chromatin remodeling complex subunit n=1 Tax=Medicago truncatula RepID=G7ISH3_MEDTR | SoyBase | E_val: 2.00E-18 | ISS | 
| UniRef100_UPI000233B16B | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233B16B related cluster n=1 Tax=unknown RepID=UPI000233B16B | SoyBase | E_val: 7.00E-34 | ISS | 
| Glyma06g08937 not represented in the dataset | Glyma06g08937 not represented in the dataset | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection | Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma.06g084900 | Wm82.a2.v1 | IGC | As supplied by JGI | 
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 | 
>Glyma06g08937.1 sequence type=CDS gene model=Glyma06g08937 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGAGACCTCTCAAGCCACACTCATCTTCCCACGAAGCGCTCTCCAATGCTTCCAGTTCGTCCGAGGAAGAGGAGCAAGTCAACGAGCAGATCAGCGAAGAGGAAGACGAGGAGGAACTCGAGGCGGTGGTGCGCCCCGCCAGTTCCGACTATGACGAAGACGATGACAAAGTTGCCGGCGACAATCCACCGAACTCCGATGAATATTCCGCTGCCGCCGATGACCTGGATGGGGATAGTGTTGATCCCGAAATTAGCAAGCAAGAGAAGACTAGATTAAAAGAAATAATGCAGAAAGTGAAGAAACAGAAGATTCAGGAGATACTGGATGCACAGAATGCGGCCATTGACACTGACATGTTACGAACAATCGAGGGAAGGGGGCGTCTGAAGTATCTCTTGCAGTAG
>Glyma06g08937.1 sequence type=predicted peptide gene model=Glyma06g08937 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MARPLKPHSSSHEALSNASSSSEEEEQVNEQISEEEDEEELEAVVRPASSDYDEDDDKVAGDNPPNSDEYSAAADDLDGDSVDPEISKQEKTRLKEIMQKVKKQKIQEILDAQNAAIDTDMLRTIEGRGRLKYLLQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||